SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022116 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022116
Domain Number 1 Region: 171-313
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-36
Family Third domain of FERM 0.003
Further Details:      
 
Domain Number 2 Region: 68-173
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-32
Family Second domain of FERM 0.0000885
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-21
Family First domain of FERM 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022116   Gene: ENSMODG00000017733   Transcript: ENSMODT00000022505
Sequence length 548
Comment pep:known_by_projection chromosome:BROADO5:1:201801874:201874169:-1 gene:ENSMODG00000017733 transcript:ENSMODT00000022505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCF
RVKFYPADPAALREEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGK
HPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPC
KDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIVLTY
FAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMESSA
KIKREPPEIHRAGMVPSRSCPSITHGPRLSSWVMTPVLSEREAETILELSLSPSAEVTRH
APRSLWSLLDWPIQAQPRPAPPPAINRGHSSERVAVIADEAYSPADSVLPTPVAEHSLEL
MLLSRQINGAPCSIEEEKESEASTPTTAEVEALGGDLKALCQSHNGPEAEQVNKFVLSVL
RLLLVTVGLLFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYFYPLRRWFACKIRS
VVSLLIDT
Download sequence
Identical sequences F7EL54
ENSMODP00000022116 ENSMODP00000022116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]