SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022186 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000022186
Domain Number - Region: 332-356
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0128
Family CCCH zinc finger 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022186   Gene: ENSMODG00000017794   Transcript: ENSMODT00000022575
Sequence length 642
Comment pep:known_by_projection chromosome:BROADO5:4:420977009:420993225:1 gene:ENSMODG00000017794 transcript:ENSMODT00000022575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMDSRGLMALTPQSEGPAKQANPAMNLSTTQENAALGPTSLTPHPRGRGSPQTSRSGSP
HNRTGMVAPELGQPEVVDDTELQMKVDFFRKLGYSSGEIHGVLHKLGLQADTNTVLGELV
KHGPATDRETPLDGPPEPPLVPRGGGTPKVPSSCSLPTEDKEVSNLRPVVIDGSNVAMSH
GNKEVFSCRGILLAVNWFLERGHSDITVFVPLWRKEQPRPDVPITDQHILRELEKKKILV
FTPSRRVGGKRVVCYDDRFIVKLAFESDGIIVSNDTYRDLQCERLEWKRFIEERLLMYSF
VNDKFMPPDDPLGRHGPSLDNFLRKKPLVLEHKKQPCPYGKKCTYGIKCRFYHPERPSRP
QRSVADELRANARLSPPRAPAKDQKCRQPSPTSTPAPGSLPVKNDRECWLPEKFLGPQQA
SGGNGDGQTKAYAQGRSLPTVSGGFGPADWGPPPLDSLSYLSQDCLDSGIGSLESQMSDL
WGGRGSSHGESGEPSRTGGSPLLTYGPEPPAGPSSVSFSGYGRPVGTGQFSIPAEYPPPL
GYAPREYWSEPYPMPPPTATRAPPALQDPHLLSAPAAYGAEAAAWGAGTDSFTKERASLR
VKLCGIFPPHLVEAVMSRFPQLLDPLQLAAEILNYKSQNPSG
Download sequence
Identical sequences F7CZ99
ENSMODP00000022187 ENSMODP00000022186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]