SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022256 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022256
Domain Number 1 Region: 129-407
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-84
Family Protein kinases, catalytic subunit 0.0000000576
Further Details:      
 
Domain Number 2 Region: 25-168
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-40
Family SH2 domain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022256   Gene: ENSMODG00000017852   Transcript: ENSMODT00000022645
Sequence length 421
Comment pep:known_by_projection chromosome:BROADO5:2:383941555:384097725:-1 gene:ENSMODG00000017852 transcript:ENSMODT00000022645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDGPGQQLQGYIPSNYVAEDQSIQAEPWFFGSIKRVDAEKQLLYPGNQNGAFLIRESE
TQKGDFSLSVLDNKIVKHYRVRRLDEGGFFLTRRRTFDTLNAFVDYYTKTSDGLCVKLGK
PCLKKEVPTTFDLSYKTVDQWEIDRNSLQLLKILGSGQFGEVWEGLWNNTTPVAVKTLKP
GSMDPRDFLREAQIMKNLRHPKLIQLYAVCTLEDPIYIITELMRHGSLQVYLQNDGGSKI
HLPQQLDMAAQVASGMAYLESQNYIHRDLAARNVLVGEHNVYKVADFGLARVFKVENEDI
YESKPEIKLPVKWTAPEAIRSHKFSIKSDVWSFGILLHEIITYGKMPYPGMTGMQVIQKL
DQNYRLPQPENCPLELYNIMLQCWNVEPKDRPTFESLHWSLEDYYYELDSSSYLDANNFI
R
Download sequence
Identical sequences F6Z7T8
ENSMODP00000022256 ENSMODP00000022256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]