SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022278 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022278
Domain Number 1 Region: 506-821
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.92e-85
Family PIWI domain 0.037
Further Details:      
 
Domain Number 2 Region: 29-375
Classification Level Classification E-value
Superfamily PAZ domain 2.98e-68
Family PAZ domain 0.00000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022278   Gene: ENSMODG00000017888   Transcript: ENSMODT00000022668
Sequence length 861
Comment pep:known_by_projection chromosome:BROADO5:4:418687168:418737944:1 gene:ENSMODG00000017888 transcript:ENSMODT00000022668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRV
NREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDMEVTLPGEGKDQTFKV
SIQWVSVVSLQLLLEALAGHLNEVPEDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYH
PLGGGREVWFGFHQSVRPAMWNMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPL
TDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQ
YFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATAR
SAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNEMTELTGRVLPAPMLQYGGRNKTVA
TPNQGVWDMRGKQFYAGIEIKVWAVACFAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQ
PCFCKYAQGADSVEPMFKHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQ
VKNVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGKK
PSIAAVVGSMDGHPSRYCATVRVQTSRQETSQELLYSQEVIQDLTNMVRELLIQFYKSTR
FKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCA
DKTERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYQVLWDDNCFTADE
LQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKDHDSAEGSHVSGQSNGRD
PQALAKAVQIHHDTQHTMYFA
Download sequence
Identical sequences F6YI56
ENSMODP00000022278 XP_001380666.2.35504 XP_020839348.1.61212 ENSMODP00000022278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]