SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022306 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022306
Domain Number 1 Region: 35-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000581
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number 2 Region: 193-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022306   Gene: ENSMODG00000017891   Transcript: ENSMODT00000022696
Sequence length 339
Comment pep:known_by_projection chromosome:BROADO5:2:378330214:378348463:1 gene:ENSMODG00000017891 transcript:ENSMODT00000022696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISKSCCRAQANGQAADGEKATQVTGVHQRKEFCHWPCQCPRQKPRCSLGVSLVKDGCGCC
KICAKQPGDTCNEAEVCDPHKGLYCDYSADKPRYETGVCAYLVAVGCELNRVHYHNGQVF
QPNPLYKCLCVSGAIGCTPLFIPKQLDSQCSGPKGGNKSDRSLCNLKLLQQQISASYQAM
PVYKNLPLFWKRKCLVQATTWTPCSRTCGLGISNRVTNENSHCEMRKEKRLCYIQPCDRN
LLKAVKIPKGKKCQPTFQLSKGEKLSFSGCLSTQSYKPIFCGKCLDKRCCIPNKSKMINV
QFDCPNEGSFTWKMMWITSCVCQKTCRDPGDIFSELKIL
Download sequence
Identical sequences F7FGP0
ENSMODP00000022306 ENSMODP00000022306 13616.ENSMODP00000022306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]