SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022321 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022321
Domain Number 1 Region: 258-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-83
Family Protein kinases, catalytic subunit 0.000000000656
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-41
Family SH2 domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-28
Family SH3-domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022321   Gene: ENSMODG00000017905   Transcript: ENSMODT00000022711
Sequence length 537
Comment pep:known_by_projection chromosome:BROADO5:2:377721153:377977300:-1 gene:ENSMODG00000017905 transcript:ENSMODT00000022711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences A0A1U7Q8Y9 F7FG65 Q62844
ENSMODP00000022321 NP_036887.1.100692 NP_036887.1.4139 XP_001368891.1.35504 XP_003504956.1.69978 XP_005073313.1.91757 XP_005363592.1.66349 XP_007484502.1.35504 XP_007643587.1.69978 XP_007643588.1.69978 XP_013207837.1.66349 XP_016286742.1.35504 XP_020863750.1.61212 XP_020863751.1.61212 XP_020863752.1.61212 XP_020863753.1.61212 ENSMODP00000022321 10116.ENSRNOP00000000733 13616.ENSMODP00000022321 ENSRNOP00000000733 ENSRNOP00000000732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]