SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022331 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022331
Domain Number 1 Region: 2583-3041
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.84e-113
Family DNA polymerase I 0.0000352
Further Details:      
 
Domain Number 2 Region: 29-67,98-174,2320-2357,2398-2582
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.25e-68
Family DnaQ-like 3'-5' exonuclease 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022331   Gene: ENSMODG00000017910   Transcript: ENSMODT00000022721
Sequence length 3155
Comment pep:known_by_projection chromosome:BROADO5:2:377201651:377457384:-1 gene:ENSMODG00000017910 transcript:ENSMODT00000022721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVRIVTADYYMASPLQGLDICQSPFTQAPVKKVPVVRVFGATPAGQKTCLHLHGIFPY
LYVPYDGCGQQPERYLRQMAFSIDRALNVALGNPSSTVQHVFKVSLVSGMPFYGYHEKER
HFMKIYLYNPAMVKRICELLQSGAIMNKYYQPHEAHIPYLLQLFIDYNLYGMNLINLAAV
RFRKVKRKSDTLHGIGCYKDQLPGNSLTGTLFRWEEDEIPSSLILEGVEPQSTCELEVDA
VAADILNRLEIEAQIGGNPGLQAIWEDEKQRRRNRNESSQISHPESQDRRCVPATESEKM
FQKRLQEVLKQNDFSVTLSGSVDYSNGSQEFSAELTLHSEVLSTETVPCSPANVVEVHQE
KELSKECFKKNILKEEEALINEEAILNLMETSQTFQPLSQRLSQSPIFMDSNPDESLVHL
LAGLESDGYQGKRHGISSSHPSFGSSRNPQNSDDEENEPQIEKEEMELSLLMSQRWDSNI
EDHCAEKRSPCRNIHRSSTEEEDSSSEEEMEWSGNNLLLANLSIPQLDGTADENSDNPLN
NESSRTHSSVIATSKMSVKTSIFHKDAATLEPPSSAKITFPCKHTSALSSHVLNKEDLIE
DLSQPNNIETGPDHTVHSLTNESPYSMKYPGSLSSTVHSENSHKESSKKEIFAVSSCESS
IFDYEEDISSLNRQISNRKYTSIRKVEKDASFMHMSHHINESTLGKNFNFSDLSHSKNKL
TSEGTEKGSSTALNNFFPSSLTENCELVSCSGESRTMVHSVEGASDEGGISKLKIRYEEF
QEHKIEKPSLSQQAAHYMFFPSVVLSNCLSRPQKLSPVTYKLQPGNKQSRLKLSKKKLVD
HQENPPSINDIGSTKEGCYLQGSTCSTNSEKDDALSNDVIRVAREAFENKAPADSCIDCH
FGDGTLESEQSFGLFGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPQSMEIGESLDGS
LKSRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMDLYKKLA
PLKDFWPKVPDSPATKYPIYPLTPKKSHRRKAKHKSAKKKTGKQQKTNNKNIKRTLSFRK
KRSHTILSPPSPSYNAETEDCDLNYSDVMSKLGFLSERSTSPVNSSPPRCWSPTDPRAEE
IITASDKEALLLFKGPNIYNSKAINSSMGKNSRAKAQVKKSKTKLVNPSVVSKKRNKRTQ
TRKPGEDGRKKPRAKQKQKISEKGSTSRKHITFKDEKINTQTNAEVKFVIKHQDLSETAN
NFGGSQSLNKQKDVSVPSPATIHPLSTPLPSIVNVQQKSPGCFPSSLENKSIDLQAFSSP
QDDLCSSLVSTPIGTGKELSKMNTQWSHNQSTIFSIKESTLIQNNIFDLSNHLSQVAQNT
QLSLNMMSTKAEENANSHKKILSSVGKLNEHHSSLDSVKSDQLHAPNFLHCKDSQQHIVC
MPEPSKHSDPYSPIHIASEENHGSLQLPNNCFVTSLRSPIKQIAWEQKQRGFILDMSSFK
PERVKQRSLSEAISQTKALSQCKNRNVSAAAFGEGQSGLAVLKELLQKRQQKAQNAHVMQ
DPISSKPQLNRSISCSLEPNKAVKRSRSVTSPRKPRTTRSTKPKEKIPKILKLDSLNLQN
TGQIDHSISDDSPIFFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSFYSGSQFVP
ADQNLPQKFLSDAVQDLFPAQTTENEFLSHDSQKCDENKHLSADPASWIRSGALSPELFD
KPPVEGNENHRHSQWKNSLHPLSSRSNSIMDSFCVQQPGECINEKSILSRNSVSKEVFLS
LPQPSDSNWIQNHTRKETSFDTVQSLDSINTSFTAILSSPDGELVDAASEDLELYVSRNN
EMLTPTPDSSPRSTSSPSQSKNGSFTPRTAHILKPLMSPPSREEIMATLLDHDLAETIYQ
EPFCSNPSDAPEKPREIGGRLLMVETRLPNDLAEFEGDFSLEGLRLWKTAFSAMTQNPRS
GSPPRNGQAVASKGSNNSHKTMEDKKIVIMPCKCAPSPQLVQAWLQAKEEYERSKKLPKI
EPTEIVKSTENLGYPVNQDDRPVVPPQNDTVLHVAPSTTGIKEDLCNSELRAQVPKGNST
ECRTVVESQTLPIVSSAGEPEKDDAEDDDYYVSYSSPDSPVLPPWQQAASPDSKLLDVND
KSCKINHKDPSPKEELNSFPMESFPKAKNGIQDSPHSETQETQTKSPCQFRAKNGKCDSY
CLHSTPIIQRRHLDRLPEANDISPLSRDPKTQKLTHRKGSSPDSLKKRILLTTQAKNQFT
AVNTPKKESSQIDGPSLNNTYGFKVSVQNLQEAKALHEIQNLTLISVELHARTRRDLEPD
PEFDPICALFYSISSDTALPDTDKTELTGVIVIDKDSTISNQGIRNQTPLLIRSGITRLE
VTYAADEKALFQEIVNIIKRYDPDILLGYEIQMHSWGYLLQRAAALSVDLCQMISRVPDD
KTENRFAAERDEYGSDTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPL
FTFRVLSDWFDNKTDLYRWKMVDHYVSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVL
TRGSQYRVESMMLRIAKPMNYIPVTPSMQQRAQMRAPQCVPLIMEPESRFYSNSVLVLDF
QSLYPSIVIAYNYCFSTCLGHVENLGKFDEYKFGCTSLRVPPDLLYQIRHDITVSPNGVA
FVKPSVRKGVLPRMLEEILKTRFMVKQSMKTYKQDRALSRMLNARQLGLKLIANVTFGYT
AANYSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKE
QSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGI
ETVRRDSCPAVSKILERSIKLLFETRDISQIKQYVQRQCIKLLEGKASLQDVIFAKEYRG
SSSYKPGACVPALELTRKMLAYDRRSEPRVGERVPYVIVYGLPGIPLIQLVRRPLEVLQD
SSLRLNATYYITKQILPPLARIFSLIGIDVFSWYHELPRIQKVTTSAHSEHEGRKGTISQ
YFTTLHCPVCDELTQHGICSKCRSQPQHVAIVLNQEIREWERQQEQLVKICKNCTGCCDR
QIQCVSLNCPILFKLSRVSRELSKAPYLRQLLDQF
Download sequence
Identical sequences F7F2R9
ENSMODP00000022331 XP_007484500.1.35504 ENSMODP00000022331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]