SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022505 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022505
Domain Number 1 Region: 201-366
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-33
Family Canonical RBD 0.005
Further Details:      
 
Domain Number 2 Region: 42-186
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-28
Family Canonical RBD 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022505   Gene: ENSMODG00000018051   Transcript: ENSMODT00000022898
Sequence length 367
Comment pep:novel chromosome:BROADO5:2:246651423:246703069:1 gene:ENSMODG00000018051 transcript:ENSMODT00000022898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNGSPKRAKSPQKPLNQLKYLLDLGPGEITRHSGEKLSPPRHVLSIRVCKEMITRHSLGY
AYVNFQQRADAEPALDTMNFDVIKGKPIHIMWSQWDPSLRKSGVRNVFIKKPNNVFVKNL
DKAIDNKVLYDTFSAFGNILSCKVVCDENGSKSYAFVHFETQYTADRAIEGMLLNDRKVF
VGRLKSRKEREVEIGAKAKEFTNVYIKNFGDDIDEERLKEIFSKYGKTECQSDDASGKSK
IFGLVSFEKHEDANKADEEMNGKDINGKMVCLGQAQKKVESQAELKWKFEVKNLDDTIDD
KKLRKEYSPFGSNTTTKVMLEDGRSRDFGFVCFSSPDEVTKAVTEMNEPIVGSKPLFVPL
AQRKEER
Download sequence
Identical sequences F7GEM7
13616.ENSMODP00000022505 ENSMODP00000022505 ENSMODP00000022505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]