SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022561 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022561
Domain Number 1 Region: 582-852
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.09e-72
Family Tandem AAA-ATPase domain 0.0000261
Further Details:      
 
Domain Number 2 Region: 328-580
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-54
Family Tandem AAA-ATPase domain 0.0000695
Further Details:      
 
Domain Number 3 Region: 87-134,161-207
Classification Level Classification E-value
Superfamily Chromo domain-like 3.16e-18
Family Chromo domain 0.013
Further Details:      
 
Domain Number 4 Region: 229-298
Classification Level Classification E-value
Superfamily Chromo domain-like 2.55e-16
Family Chromo domain 0.0048
Further Details:      
 
Domain Number 5 Region: 2-40
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000162
Family PHD domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022561   Gene: ENSMODG00000018094   Transcript: ENSMODT00000022955
Sequence length 1563
Comment pep:known_by_projection chromosome:BROADO5:8:107954153:107981472:-1 gene:ENSMODG00000018094 transcript:ENSMODT00000022955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKEDNSEGEEILEEV
GGDPEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPS
LKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSW
VSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGEEEKSRKRKNKDPKFAEMEERFYRYGI
KPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEVQDYDLFKQSYWNHREL
MRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWL
RFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMW
APDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITI
DMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLN
FLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVE
LSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPN
GMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERID
GGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAF
SRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDD
ILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYL
SSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGK
RIRKQVNYNDGSQEDRGVSGRPHPLPLGRSPRAVGPAHLPSLPPDWQDDQSDNQSDYSVA
SEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIM
RYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSR
QHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDT
QPNTPAPVPPPDDGVKTEENNNKEEENAEGEREVKPAASEASVEGTQPSTSNPEEEKVLT
EPLEGEEKVDKPEVKEKTEESMETETKGVAEMEKTEEKSAVDLTPIVVEDKEEKKEEEEK
KEVMLQNGETPKDLGDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIW
HRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLL
EQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAV
LHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRGPEPTPQQVA
QQQ
Download sequence
Identical sequences F7FFR7
13616.ENSMODP00000022561 ENSMODP00000022561 ENSMODP00000022561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]