SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022630 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022630
Domain Number 1 Region: 333-503,543-628,661-689,750-857
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-85
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00057
Further Details:      
 
Domain Number 2 Region: 186-294
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-37
Family Zf-UBP 0.000000846
Further Details:      
 
Domain Number 3 Region: 709-771
Classification Level Classification E-value
Superfamily UBA-like 3.71e-18
Family UBA domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022630   Gene: ENSMODG00000018148   Transcript: ENSMODT00000023028
Sequence length 859
Comment pep:known_by_projection chromosome:BROADO5:8:108309718:108323875:1 gene:ENSMODG00000018148 transcript:ENSMODT00000023028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGVAGAVLCGSAAAGVMAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLY
ICMNTFLGFGKQYVEKHYCRTGQRVYLHLQRTRRPKEDDSTSGTGDPPRKKPTRLAIGVE
GGFDITEKYEYDEDVKIVILPDYLEIARDGLGGLPEMITSAVEALLAADSASRKQEVQAW
DGEVRQVSKHAFNLKQLENPARIPPCGWKCSKCDMRENLWLNMTDGSILCGRRYFDGSGG
NNHAVEHYKETGYPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLAHFGIDMLKMQKT
DKTMTELEIDMNQRIGEWELIQESSVQLKPLYGPSYTGIRNLGNSCYLNSVVQVLFSIPD
FQRKYVDKLEKIFQNAPSDPTQDFSTQVAKLGHGLLSGEYSKPAPESGDGEQVPEQKGIQ
DGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHFINMVERNCRSSENPNEVFRFLVEEKI
KCLATEKVKYTQRVDYIMQLPVPMDAALNKEELLEYEERKRQAEEEKQPLPELVRAQVPF
SSCLEAFGAPEQVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDV
SIEMPEELDISQLRGAGLQPGEEELPDIAPPLVTPDEPKGSWMTPVYPPPPTAPMLDESV
IIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLVLPGSSGPGSTSTV
ADPPSEDCVATIVSMGFSRDQAMKALRATNNNLERAVDWIFSHIDDLDAEAAMDISEGRS
AADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCA
SEKPPKDLGYIYFYQRVTS
Download sequence
Identical sequences F7CWU5
ENSMODP00000022630 13616.ENSMODP00000022630 ENSMODP00000022630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]