SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022636 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000022636
Domain Number - Region: 109-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0548
Family Canonical RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022636   Gene: ENSMODG00000018155   Transcript: ENSMODT00000023034
Sequence length 218
Comment pep:novel chromosome:BROADO5:2:351878292:351904577:1 gene:ENSMODG00000018155 transcript:ENSMODT00000023034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPSCPRNLIAYNILSTLEITSHQYLLSLGILLLIAESVINKVLLEPVFKEGTQTCQGSS
YDSCKKGTVSPVNKVATLTKAVIILGKKGAKAAAIPVKVEGVQSEDAIEVRLGFIKNGMP
IGITYIEFKTETDVHKALDEKLETETYEWALILHYKEDGKATKEGQEEGEIDRNEITLDW
AKFSDFGGRGGSHGSRKELEEEMTEEEAFAIKEDAGMK
Download sequence
Identical sequences F7CWQ7
13616.ENSMODP00000022636 ENSMODP00000022636 ENSMODP00000022636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]