SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022637 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022637
Domain Number 1 Region: 243-521
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.9e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000387
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-28
Family SH2 domain 0.0000108
Further Details:      
 
Domain Number 3 Region: 92-213
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-25
Family SH2 domain 0.0000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022637   Gene: ENSMODG00000018156   Transcript: ENSMODT00000023035
Sequence length 596
Comment pep:known_by_projection chromosome:BROADO5:8:108438809:108460403:1 gene:ENSMODG00000018156 transcript:ENSMODT00000023035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHISGAQA
ETLLQAKGEPWMFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEASRYTVGG
SETFDSLTDLVEHFKKTGIEEASGTFVYLRQPYYATRVNAADIENRVLELNKKQQAEETS
KAGFWEEFESLQKQEVKNLYDRHEGQRPENKSKNRYKNILPFDHTRVILQGRDSNIPGSD
YINANYVKNQLVSADENAKIYIASQGCLDATVNDFWQMVWQENSQVIVMTTREVEKGRNK
CVPYWPEVGTQRSYGLYSVFNCKEHDAPEYKLRYLQVSPLDNGNLVRKIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQCQESLHNAGPIIVHCSAGIGRTGTIIVIDMIMEAISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYMAIAQFIETTKRKLEVLQAQKGQVESEYGNI
GYPPAMKNAHAKASRTSSKHLEDVYENLQSKSKKEDKMKKQRSAEKEKSKGSLKKK
Download sequence
Identical sequences F7CWQ1
ENSMODP00000022637 ENSMODP00000022637 XP_007503742.1.35504 13616.ENSMODP00000022637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]