SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022797 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022797
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.28e-23
Family Canonical RBD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022797   Gene: ENSMODG00000018282   Transcript: ENSMODT00000023200
Sequence length 245
Comment pep:known_by_projection chromosome:BROADO5:2:346338650:346351391:-1 gene:ENSMODG00000018282 transcript:ENSMODT00000023200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRYTRPPNTSLFVRNVTDATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYLVIFE
DVRDAEDALYNLNKKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSEHRRSRSHSRRT
RSRSSSWGRSRRRSDSLKESRRRGLSYSRSKSRSNSLTRHSTSGRKSRSPRRNSSSRRRS
RSESLQKRTTSVGKSQSSSPQRQTTSGAKSRSGGRHFDSLARSPSKSPQRHTNSETKAQS
RSYHH
Download sequence
Identical sequences F6Q6E1
ENSMODP00000022797 13616.ENSMODP00000022797 ENSMODP00000022797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]