SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022828 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022828
Domain Number 1 Region: 848-1036
Classification Level Classification E-value
Superfamily Macro domain-like 4.04e-51
Family Macro domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 1069-1250
Classification Level Classification E-value
Superfamily Macro domain-like 1.6e-41
Family Macro domain 0.00018
Further Details:      
 
Domain Number 3 Region: 1278-1459
Classification Level Classification E-value
Superfamily Macro domain-like 8.24e-35
Family Macro domain 0.00088
Further Details:      
 
Domain Number 4 Region: 1681-1810
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.85e-17
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.035
Further Details:      
 
Domain Number 5 Region: 1576-1665
Classification Level Classification E-value
Superfamily WWE domain 6.67e-16
Family WWE domain 0.0088
Further Details:      
 
Domain Number 6 Region: 277-354
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000622
Family Canonical RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022828   Gene: ENSMODG00000018308   Transcript: ENSMODT00000023233
Sequence length 1816
Comment pep:novel chromosome:BROADO5:4:87086018:87211868:-1 gene:ENSMODG00000018308 transcript:ENSMODT00000023233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERCFPRKGNRKFSKLLRRNVEPGLSDFLGKGNQKQFSELAGKSPEPGLKGNMASSGPF
PLVLEGPWDADPPKQLCNKLQRYFQSPRISGGGECDLKKQTGQHGLLLLFKQEEVRQRVL
KRENHELELPGQEKLKLTVRLPPAKNENKISEKPVTTEEPKIKDGAQEQEVSGDQDTKHP
LERRSAQAEGNSEDARTISSLVVFNNVHHAIREDFLTLLVENISGFSEINGDFTIEILPE
AQAAVITFLKTIDTEAFVIICTQNHRVKDLKISASTLEMTRTILVEDLPPGVNEIFISLF
FENPHNGGGPVTMVQYFPNDNSALVEFETHEVIDTLLTKKLLFNNSPISVYPYYPTLKSA
LYGKAKPLVKLPDPLTVPMEPYILKFLQKGDQVIDEITSTMERCFCELTWPQPNCEEPEI
ILSPSDSLVSQGRTKRNTIKTWNQDISKTFSDLMSEYQVNTYKVDPLVWEAIRDSIENEG
ILTEFDEHQETVIRVGRLEDMQGTELQVKTQIERATQKIGREKQTIKEKLIVCPRRFSIL
HNKLEETLHKEHKDVEVTYEALTKSICLSGLATDVYKAKSKILEKLQSLVQKYLHIPPQI
VQFLQQVNCETFSESLFSADKISAIYEVEGEAILLVGSSPQVLSEAEEHIQKALDYKCID
VVDSEILNDCQWKTLIDSLNKKYSSSSKTMIIEEQNTDTGVKIMIAGCVSPVCESYQLLC
EFIEKNTKVQKFVAVISLAVIEYMKVENEQIWHSLRMKKVKIDFKTHVNERGILLSGPKE
EVMRGVAMVKKTRNSVHVKKVSIDEPGVKVFSKTKKNCIQGKQNKSLIVLFWLQENGDEG
NGGSIDGQKVHCKITLESGILLTVQEGDLTQFSADVVVNAANEDLNHCGGLAAALSEAAG
PELQRECSQIVQQQGKISPGSAVVSGAGQLPYQQVIHAVGPRWREEHAQSCVQLLKNAIT
MSLLIAGFHGHQSIAIPALGSGIFGFPLKDCAEAIVLSIKTKFQDPSNKQSLKMIHLVDS
SEERVQAFSEAVRKNFGDLSPGNKSAFGMQSENQDTKLRKEDTCGKVLASIKTTEGLSIL
LLKGDIQNAETDIIVNSISLDFPLNGALSQAILKKAGPSLQEELNTVRNRIEMKIGSVLL
TSGCNLNCIFVLHAVIPPWDEGKGDSQKIMEDIIRECLETPEILSLTTVTFPAIGTGLAN
FPKAIFAELILSQVFKFSSTRPCKTLKEVRILLHPRDQENIKAFLNEFSKWTSRSRNENS
TSCRVAKTMNGQGLISLGTISNTAPGVYETTIGSISFIASGDIAKEQEDVIVNSTCNSFV
YKGGVSKAILEAAGQDVELECAALASKPHGNFIITQGGNLKCKKIIHVLGHKDIKETVSS
VLQECEKMKSKSVSLPAIGTGQAKQDPVVVAKKIIDSVEDFAWKGSAQSVKKVKVVILPE
LLEVFYDSMKRREASPVPTFMFLKLKVSIFLVLLGLIKHNFALGKKIKSTIFQICGESEE
NVESTASWIQDLTLKEQESYLSSDELIQNFGEKEFKELNTLQKSLNIIISPRNNFCLQAT
GLAKDVLKATKTIEDMIRRACLRREEDSKAEQLSHFIQWQYNQNGVFLSFDKITNFYLEK
AREEKKNTVDIKIKNKSCTVNFHTNIATDTNGHSFPVQRITKSEDVIPTHWANMKEQNLL
LVELKPDQQEYMIVQNNFNKTCSNYYIEKIERIQNKSLWSSYETIRKNMNNQNYRTDNER
FLFFGTKADSLLKINNNGFNHNYIRNKYAWRRKIYFTVSAFFAASDDHSPPDRYGQKFIY
YARVLTGIFRTIYKME
Download sequence
Identical sequences F6PVF6
ENSMODP00000022828 ENSMODP00000022828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]