SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022840 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022840
Domain Number 1 Region: 795-987
Classification Level Classification E-value
Superfamily Macro domain-like 3.87e-51
Family Macro domain 0.0000943
Further Details:      
 
Domain Number 2 Region: 1225-1398
Classification Level Classification E-value
Superfamily Macro domain-like 2.69e-43
Family Macro domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1640-1821
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.11e-42
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.016
Further Details:      
 
Domain Number 4 Region: 1021-1199
Classification Level Classification E-value
Superfamily Macro domain-like 1.06e-40
Family Macro domain 0.00015
Further Details:      
 
Domain Number 5 Region: 1524-1622
Classification Level Classification E-value
Superfamily WWE domain 6.93e-16
Family WWE domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022840
Domain Number - Region: 225-286
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000337
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022840   Gene: ENSMODG00000018318   Transcript: ENSMODT00000023245
Sequence length 1822
Comment pep:novel chromosome:BROADO5:4:87306996:87377997:1 gene:ENSMODG00000018318 transcript:ENSMODT00000023245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGGSAHGPPWRVLVRVSENCSGLEKKLEKYFQRRKKSGGGECTVKAGPSEGTFWVEFL
ESQARQRVLENKRHELELSREEKLTLTVTLPTAKQEDEDNEEPVPKEESKIKNGAQEQDA
SEDQDTEHPLDRMLDETEDMARESGNEPHLVAFKNAQDLEEYLLILLVENISGLSKNEGD
FEVEILPEVESVVLTFLKPFDTRRFIDRCFQNRIVQERKIFVAPLEVTRTILVENLPRDV
DENYVTLFFENPKNGGGSIKKVQCLPKVNSALIEFSECKVVKTILTKKLLFNNSPLSMFP
YYHSLGTALYGKAKPPAELPEPLKVPIEPYLLKFFHQDDGVIKDITRTMENFHCELTWPQ
LSCKEPEITLSPSATLVSQRRTKNNIIKTWIEDVSMRFSSLMSEYQVRKYNVDLVVWEAV
RDSIGNERVLIEFDKLQETVIIVGRLEDVQKIEPEVKTQIEKATQKIERKKQSIRSEFTV
CPGRFSILLNNGLEETLHKEYPELEVTYNSLTKSICLSGLQAEVYKAKSEILEKLHSLAQ
KSFHIAPQIVQFLQQVDCETFSEYLFAAKKISAIYLMEGKDILLFGSSPQVLSEAEQHMQ
KALGFKCIDVVDSEILNDYQWETLTDEMNKKHNYSSKTVIIEEQNSDTGVKIMIAGCVSS
VDESYQKLYGFIEKNTKIKELVPVKSLTVIQYIKEENEPILENLKKNKVKIDFRTLANER
GISLSGPKEEVMKGMPVVKQILESIHVTNFSIDKPGANVLFKDKEEIYKMEAKSKFNCLI
RLLEDGDEGNGGSIDGQKVHCKITLGSGILLTVQKGDLTQFPADVVVNAANEELQHHGGL
AAALSEAAGPALQRECDQIIKQQGRIRPGCAVVSGAGQLPYQQVIHAVGPRWRKEHAYRC
ELLLKNAVTECLYQAELSGHTSIAIPALSSGHFDFPLKTCTETIALAIKENFQGLRHKCS
LKEIHLVDSSEKTAQAFYEAVKTVFKDAFPSNDLLPFTPPESQKTTVRKSTEHRNALASI
EAGELSIILIKRDIQDAKSDIIVNTIATDLQLDKAPLSQAILKKAGPELQKELNILGKET
TVKPGHVLPTGSYNLDCKFILHVVASPWNNGVGNAKMIMKESIKACLETTDSLSLTSITF
PAIGTGKLGFPKATFAKLILSEVLKFSSSRPLKSLKEVYFLLHPSDTDNIQAFKREFSRY
TDGTTTSDRASNISDTEEDFLDTIYDSDLGIYKGKIGSLTVQVAPGDITKEESEVIVNST
NESFLLKNGVSKAILDAAGPAVESECAQLAVKPHQNYIITQGGNLGCKKIIHVIGGLDVY
KTITDVLQECEKMKYTSISLPAIGTGQAQQDPTKVAESMIDAIENFTQKGSGQSLKEVKM
VIFQPQLLKVFGDSLEKRISSMAPISASPSPPTSGSGYFSSMLQSVRKTLGFLSQPGKKQ
DPCVLENVEKSATFQVCGKSKTNVKNAISWLKNLILLEQDTHIYSDESILYFGEKEYSEM
NVLQKKLPIRIVIKHGESHLEILGPSKDVLKASRKIDEMIQGVRSQKRAELLSSSIQWQY
DDNGVFKSFDKMTNMKIEDAKKGRKKSIDVEIAGEIYTLDFSSNEATNAKGRSLSVNRFK
KSEVEIPSHWLTMKNTNLLLVDLKSQDPEYKKVNDEFLRTCPNFKIEKIQRIQNIILWNL
YKTKKTLMDEQNPQAKNERCLFHGTDVDSLSHVNSQGFNRVYAGKNATAYGKGTYFAVNA
SYSSSDTYSKPDQNGKKYMYYVRVLTGDYTLGNSSYLVPPPKNAQNSDVLFDSVTDNMQN
PSLFVIFYDNQSYPEYLITFRK
Download sequence
Identical sequences F6PTL6
ENSMODP00000022840 XP_007493852.1.35504 ENSMODP00000022840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]