SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023020 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023020
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.38e-37
Family Calponin-homology domain, CH-domain 0.0000901
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.89e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 3 Region: 906-939
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000396
Family LIM domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023020
Domain Number - Region: 940-968
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0157
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023020   Gene: ENSMODG00000018463   Transcript: ENSMODT00000023430
Sequence length 1859
Comment pep:known_by_projection chromosome:BROADO5:8:120718125:120941939:-1 gene:ENSMODG00000018463 transcript:ENSMODT00000023430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESRNEKMNEAHILFDRFVQASTCKGTLKAFQELCDYLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYRKGKVCTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVYPPEDQENERIGWRAQVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRHTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLEKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTNQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGISPLEVLAERESIYRLLPQTTPENVSKNFSRYSIDPVTRYPNINVNFLR
PNQVLHLYDTGEMKDVHLEMENLVNSQVTPKLTRNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEHNTEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSIPSSVTLDAEEKAVLIASTKSPISFLSKLGQSIS
RKRTPKDKKEKDLDGVGKRRKTSQSEEEEPPRGYREERPTLVSALTERRIDVAIGNQNKV
KSMATQLLAKFEENAPLQSTGSIRRQPIQERCISQPSRRQPEQGRPAPIPQWKQQRRKEC
SRTCPKKVITLTPPSIPPSRSYCSQQMYRDLDADNRGKRSPLSERQETEPSRRFFVEQWE
LSLSLRSSNRPASPSSDSLRQKYIKMYTGGVSSLAEQIANQLQRKEQPKTLLDKKELGSL
KKEFPQNIGGSDICYFCHKRVYVMERLSAEGKFFHRSCFKCEYCSTTLRLSCYAYDIEDG
KFYCKPHYCYRLSGYAQRKRPAAAPLSGKETKGPLQEGTTADRTGRSNSTTSSVERTPGS
SVNGLEEPSLAKRLKGTPERIELENYRLSMKQAEELEEVPEETLAEHNLSSVLDKGTEED
AASRHERREYDYIFGVRESKKLKINLRLGTSDIRSSVPWKEAVRIHALLKGKTGNLKLQQ
IVNLVDPLEIQADVHWTHIREKEEEDKMVSTSKSSSSRGNCPKVQDPLEPGDTDMLVSRW
GPGDTGDTGALLDDDQRWSDDIPSEAEGVLGLQCQEAIKRELKLEVSEKEEEQPTSPPQQ
GKGPSLPPSPSKSLLERTDLLSPVKAKAEVIPFSSVFNKEKSPEEHIFPDTFLIKEKPEG
EIPIDQKVLNTSGTLSPIRSQPAALPEAIVTTSPVVSRPVSPSVSSSSPSAQLPICSQPQ
PSSETSIPSPTESPICFQPSPIITSTPLVSLSRKDKDDTVEKPSSPVATDEPIKRNDLVE
EFWLKSAEIRRSLGLTPIDRKKSTEPSFTLPSLDSVSLKSYSIKKVSQDEEIHLLKRQPS
PRRPGMPKLESDPPSLLTPKSPSEKELKSLIHEERKDLSSSSGLGLHGSSSNMRTLASQS
FNTSDSTMLTPPSSPPPPPPPDEKPATLRRKKQASWQKDAELKPSSAPIMRSHPEPAQPS
REEVRKSFVESVDEIPFADDVEDTYDEKTEDTSFQEKFFTPPSCWPSSEKALCPPLVKEN
GRLPTLEGESQQQKRELPMVSAEAKELAKERMRAREKSVKSQALRDAMAKQLKKMKEMEM
TAAAAGTSRISSKQLGLEPLKHSALRRSEIPTLKHEATSEDFFSPASDSGGPDGSVTSSE
GSSGKSKKRSSLFSPRRSKKEKKSKNEGRTVEKPSGNLLEESAAKPKSLWKSVFSGYKK
Download sequence
Identical sequences F7CAX8
ENSMODP00000023020 ENSMODP00000023020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]