SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023050 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023050
Domain Number 1 Region: 239-349
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-17
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023050   Gene: ENSMODG00000018490   Transcript: ENSMODT00000023462
Sequence length 363
Comment pep:novel chromosome:BROADO5:8:121319077:121320244:1 gene:ENSMODG00000018490 transcript:ENSMODT00000023462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEWSDDFDSDYENPDEPSNSETYVVPGEETADDSYEPPLTEKEKRKLPTALPFSKGEYAD
NRSHQRHSPPFSKTLPDKVDYVVPVEDEDENYIHPTESNSPSSEYAPKVNRSVKLSSSAS
PNPLSRVLALAPEIHATAWEPKSPSSIQAPSPLPRALKKTPTQQKTAPGLPHQNTWTDHE
EKPISAERHRGRVPGQRLELRQQPAFPTVNKPVQQKPIPPPKSPEVLSSSMDIPLPGFPT
NYCLSDQEAEIHCKPWYGSCDRKSAEAALYKSNRDGSFLIRKSSGHNSKQPYTLVVFYNR
RVYNISVPYIETTKQYALSSKKKNEEHFNSVADIIKNHQHTPLVLIDSQNNTKDSTRLKY
AVS
Download sequence
Identical sequences F7BRR8
ENSMODP00000023050 ENSMODP00000023050 13616.ENSMODP00000023050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]