SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023122 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023122
Domain Number 1 Region: 266-364
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-27
Family SH2 domain 0.0004
Further Details:      
 
Domain Number 2 Region: 188-290
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-23
Family SH3-domain 0.0000669
Further Details:      
 
Domain Number 3 Region: 111-169
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-22
Family SH3-domain 0.00064
Further Details:      
 
Domain Number 4 Region: 5-61
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023122   Gene: ENSMODG00000018540   Transcript: ENSMODT00000023535
Sequence length 377
Comment pep:known_by_projection chromosome:BROADO5:4:98739290:98807669:1 gene:ENSMODG00000018540 transcript:ENSMODT00000023535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNRTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKHSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLTKGTKVVVMEKCSDGWWRGSYNGQVGWFPSNYVTEESDSPLGDHMGSLSEKLA
AVVNNLNSGQVLHVVQALYPFSSSNDEELNFEKGEIMDVIEKPENDPEWWKCRKINGQVG
LVPKNYVTVMQNSQITSGLEPSPPQCDYIGPSVTGRFAGNPWYYGKVTRHQAEMALNERG
NEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKDTVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLIKHLS
Download sequence
Identical sequences F7GD33
13616.ENSMODP00000023122 ENSMODP00000023122 ENSMODP00000023122 XP_001365145.1.35504 XP_007493980.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]