SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023144 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023144
Domain Number 1 Region: 1885-2133
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-57
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 979-1314
Classification Level Classification E-value
Superfamily L domain-like 8.16e-49
Family Internalin LRR domain 0.067
Further Details:      
 
Domain Number 3 Region: 1334-1494
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.57e-25
Family G proteins 0.0025
Further Details:      
 
Domain Number 4 Region: 172-321,355-513
Classification Level Classification E-value
Superfamily ARM repeat 3.34e-23
Family Plakophilin 1 helical region 0.038
Further Details:      
 
Domain Number 5 Region: 2197-2498
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000119
Family WD40-repeat 0.025
Further Details:      
 
Domain Number 6 Region: 402-764
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000978
Family PBS lyase HEAT-like repeat 0.094
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023144
Domain Number - Region: 11-235
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family Mo25 protein 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023144   Gene: ENSMODG00000018556   Transcript: ENSMODT00000023557
Sequence length 2528
Comment pep:known_by_projection chromosome:BROADO5:8:124784170:124971434:1 gene:ENSMODG00000018556 transcript:ENSMODT00000023557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSSLEDEENEEGILEKLTVRLQYVQEGKQIETVIQILEDMMLLTFTDHAAKLFKGKN
VHIPLLLVLDSYMRVASVQQAGWSLLCKLTEICPDIMQSLMGPQDVGKDWEVLGVHQLIL
KMFTVHNANITLSVIGLKTLDQLLTSDLMTLRILEEDCSDVFTLIFDAMHTFTTNEEIQK
FGCKVLHVLFGKVSEEQLTEFIENKDYMFLLNALKRFNHEEEVVFHVLHSLHSLALPCSN
VEVLMSGNVRCYNIVVEAMKMFSNSEKIQEVGCCLLHRLTLDNFFNILVLNEVHEVIVKA
VKKYPMNAPLQIAALSCLALLTETIILNRDLEEKNENQEDDEDNKLCWLEASYRALTLHR
KNTHVQEAACWALNNLLIYQSNLHENIGDEDDQYPAHREMVLSMLMHSSSKEVFQAAANA
LSTLSEQNVNIRKALLTKGIYWNVLQLMMRHLDFPEVAESGCRMLNHLLEGSNLNLDVMA
SVTSHIIEVMKNHKTSSAVQLEAFRAILHIIVPESKKEHEEDSSLNINLKVIKNSCLLND
IHKLVLGALNKFIGNPGIQICGLKIISSLVNCSGALEMFSQQGALDSVLHTLQMYPDDRG
IQCLGLSLLGSLITKKNLCTETQDLLANILVSSLQRFKDVVEVQISGFQTTLAILELSLC
FARLLLNYHSYDSLIFYQLSRCFTEQMDHQFQNLCCKFFAKITSDDDIKNVLLVRACEEN
NSFMAECLLLLGADINKVNGKTSLICQVCEKESNPKLVELLLNNGSREQEIRKALMISIK
KNNSQVISLLLRKLGLDLANNSICLGGFCIGKIEPSWLSPLFPDKASNLRKKTNAGSALA
RMILRYQMKSLSEDGTMPSNDGSFPEDHLDKYGDWTFIPESSIDYVFAHSDDLDSEGSEG
SFLMKKKSSSFNVGDLYKDNALQLGSATLERHSTSMETSFDHEELLKKRRDLFSSDDSVQ
GSSKFHSHLRQSDSVFSLTSERECIKSLDLSANELEDIDDISKKCCLSDHLTRLEKLELH
QNSLKRIPQQLCETLKCLKYLDLHSNKITSIPAYFLKMNCITNLDISRNDIGPSIILDPT
IRCRTLKLLNLSYNQLSSVPEFLADVIENLEQLLLEGNKISEIHSPLHLKELKTLNLSKN
HLFSITDDFFETCGKLEVFSARMNLLVTMPRLPSSITILNISQNKFTCVPEVILSLPHLR
SLDLSSNEIHSLPGPAHWQSLNLRELLFNHNQISILDLSEKAYAWSRMEKLHLSHNKLKE
IPPEIGFLENLTSLDVSYNLELRSFPNEMGKLTKIWDLPLDELHLNFDFKQIGCKTKDII
RFLQQRLKKAVPYNRMKLMVVGNTGSGKTTLLRQLMKSKKRELSLPSTTVGIDVKDWFIQ
LWSKGKKELILNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGYAEVDAMKPWLFNIK
ARASSSPVILVGTHMDVSDEKQRKTSIIKITKELLNKRGFPEIRDYHFVNATEECEALVK
LRKSIIKESLNFKIRDQPVVGQLIPDCYLELEKKILLERKNVPTEFPVINQKQLVQLVKE
SQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKMMAQILTVKVEGFA
KYPKGIIQRSDVEKFLSKKSRFPKNYMSQYFKLLEKFQIALPIGEEHLLVPSSLSDHRPV
IELPHCENSEVIVRLYEMPYFPMGFWSRLISRLLEISPYMLSGRERALRPNRMYWRQGIY
LNWSPEAYCLVESSILDNSSESFLKITAPSCRKGCIILGQVVDHIDSLMEEWFPGLLEID
VCGEGETLLKKWALYSFNDGEEQQKILLDDLMKKTEEGDLLINPDQPRLTIPIGHIAPDL
ILADLPRNIMLNNDDLEFEQAPEFLLGDGGFGSVYRASYKGEEVAVKIFNKHTSLRLLRQ
ELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVA
DGLRYLHASMIIYRDLKPHNVLLFTLYPNSAVIAKIADYGIAQYCCRMGIKTSEGTAGFR
APEVARGNVIYNQQADVYSFGLLLYDILTTGSRILEGLKFPNEFDELAILGKLPDPVKEY
GCTPWPKVENLIKKCLKENPQERPTSAQVYDILNSAELICLMRYILIPKIFIAECMVATT
QSSKNAIIWLGSGNNDAGQLSCLEINSERHTSENVTESRILCLALVCLLVEKESWIVAGT
QSGTLLAVKTEDDKKSHVLQRMTDSVTCLYCNSFSKQSKQKNFLLVGTANGRLAIFEDRS
IKYEGAAPLKTLNIGNVSTPLMCLNESIYSSEKNIIWGGCGTKIFSLSSDFSIQKFIETK
ANQLFSYATFSDSNIISIVVDKAIYVAKKNSHFVEVWDKKTEKLCVLIDCVQFLKERMVL
VNKESKYKMIYSGRVKTLCLQKNTALWIGTGGGHILLVDLSTHRIIHIIQNFCDSIRAMM
TVQLGSLKNVILVLGYCQKNSESTQHQKEMESCLSVWDINLPHEVENLAKHTEVRKELAE
KMRSISME
Download sequence
Identical sequences F7G2I3
ENSMODP00000023144 ENSMODP00000023144 XP_007503958.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]