SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023377 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023377
Domain Number 1 Region: 63-173
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.94e-29
Family Canonical RBD 0.00000837
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023377   Gene: ENSMODG00000018752   Transcript: ENSMODT00000023793
Sequence length 174
Comment pep:known_by_projection chromosome:BROADO5:2:494375867:494381661:-1 gene:ENSMODG00000018752 transcript:ENSMODT00000023793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD
GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE
YETYKEAQAAMEGLNGQDMMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
Download sequence
Identical sequences F7EF23 G3X2V4
ENSMODP00000023377 13616.ENSMODP00000023377 ENSMODP00000023377 ENSSHAP00000022009 XP_001363861.1.35504 XP_003769907.1.9362 XP_020859463.1.61212 ENSSHAP00000022009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]