SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023398 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023398
Domain Number 1 Region: 12-183
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.76e-50
Family Canonical RBD 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023398   Gene: ENSMODG00000018767   Transcript: ENSMODT00000023814
Sequence length 424
Comment pep:known_by_projection chromosome:BROADO5:2:495042680:495047853:-1 gene:ENSMODG00000018767 transcript:ENSMODT00000023814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE
FLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTF
SAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKK
DSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPP
GSFPPPVPPPGALPPGIPPAMPPPPMPPGAGAHGPPSAGTPGAGHPGHGHSHPHPFPPGG
MPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGS
PMGHPGPMPPHGMRGPPPLMPPHGYSGPPRPPPYGYQRGPLPPPRPSPRPPVPPRGPLRG
PLPQ
Download sequence
Identical sequences F7DXP0
13616.ENSMODP00000023398 ENSMODP00000023398 ENSMODP00000023398 XP_001365466.1.35504 XP_020859845.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]