SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023402 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023402
Domain Number 1 Region: 809-838
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000527
Family A20-like zinc finger 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023402
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.000459
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023402   Gene: ENSMODG00000018770   Transcript: ENSMODT00000023818
Sequence length 847
Comment pep:known_by_projection chromosome:BROADO5:2:495062648:495155430:-1 gene:ENSMODG00000018770 transcript:ENSMODT00000023818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVSAALSDFEQLRQVHAGNLPPPFSEGR
GGPRPPEKGPPEREPTRPPRPTLHRQDDIIQEKRLSRGISHASSSIVSLARSHVSSSGGT
GGSSEHPLEMPICAFQLPDLTVFTEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTC
QRLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKALYSLMEKGVEKEALKRRWRWQQTQ
QNKESGLVYTEEEWQKEWNELIKLASSEPRMHIGTNGASCGGVESSEEPVYESLEEFHVF
VLAHVLKRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASRCHRSPLVLAYDQAHFS
ALVSMEQKENSKEQAVIPLTDSEHKLLPLHFSVDPGKSWEWGKDESDNIRLASVTLSLEA
KLHLLHSYMNVKWISLPSDTQAPLAQPESPTASAGDEPRSTPESGESDKESVGSNSTSNG
GGGRKEKPKRDREKDKKRADSVANKLGSFGKTLGSKLKKNMGGLMHGKGTKPVGIGVGPG
VQPSGSDTLEKKKKGSLKGWKGSKEDTSGDVSGSEKPIPESPGDGGNKYSQEVRLSLSIM
RIAMQGERKFIFAGNLKMSHRHQYQEEMIQRYLADAEERFQAEQKQKEAERKMNGGSGSG
PPPAKKQEPDGEEELLNPSPPESKASLSPSHPGGFTIPRPAGGGVHCQDLGRQVAGGPCG
GLPSYATFPRQCTSGRLYPNQDPVTSLERNSHSMDGNQGESLLPSPFRVADSYSNGYREP
PEPDGDGGWGGGTVEDLGLPLTQTKCKQPNCSFYGHPETSNFCSCCYREELRRREQERGG
ELLVHRF
Download sequence
Identical sequences F7AE38
ENSMODP00000023402 ENSMODP00000023402 XP_001365536.1.35504 XP_007485423.1.35504 XP_016284626.1.35504 XP_016284627.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]