SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023499 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023499
Domain Number 1 Region: 28-187
Classification Level Classification E-value
Superfamily PR-1-like 2.09e-49
Family PR-1-like 0.00000507
Further Details:      
 
Domain Number 2 Region: 189-243
Classification Level Classification E-value
Superfamily Crisp domain-like 2.98e-16
Family Crisp domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023499   Gene: ENSMODG00000018838   Transcript: ENSMODT00000023915
Sequence length 244
Comment pep:known_by_projection chromosome:BROADO5:2:296930933:296969034:-1 gene:ENSMODG00000018838 transcript:ENSMODT00000023915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLLLYFFLLPFLFPKVSKGELLKVPYDAISTKSVNIQEEIVGKHNALRRGVIPRARNML
KMEWNEKAAQNARNWAKECEMTHSATFKRQITDIFCGENLLFSSDPLSWSDVIQIWYDES
ENFKYGFGPIKPGLVVGHYTQTVWSTSYMIGCEVAHCPSRETYKYFYVCHYCHRGNNPDT
STPYKKGIPCGDCPHHCEDGLCTNPCAYADDAGNCPDAISSLGCHHKLVAKSCKASCKCT
TEIK
Download sequence
Identical sequences F7GKA3
ENSMODP00000023499 13616.ENSMODP00000023499 ENSMODP00000023499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]