SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023634 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023634
Domain Number 1 Region: 232-279,354-388
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000217
Family Canonical RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023634   Gene: ENSMODG00000018941   Transcript: ENSMODT00000024054
Sequence length 831
Comment pep:known_by_projection chromosome:BROADO5:2:289008885:289043970:1 gene:ENSMODG00000018941 transcript:ENSMODT00000024054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAATMPSLLGSVVLNASEPRDYCYSARIRSTVLQGLPFGGIPTVLALDFLCFLLLLFLFS
VLRKVAWDYGRLALVTDVDRLRRQQRDRVEQEYMSSATQADSHDRYERLTSVSSSVDFEQ
RDNGFCSWLTAIFRIKDEEILDKCGGDAVHYLTFQRHIIGLLAVAGVLSVGIVLPVNFSG
NLLENNPYSFGRTTIANLDSSNNRLWLHTSFAFLYLLLTVYTMRRHTSKLRYKEDDLVKR
TLFINGISKYAESENIKKHFEEAYPNCTVLEARPCYNVAKLMSLEDQRKEAERGRIYFSN
LRARENTPTMINPKPCGHLCCCVVRGCEEVEAIQYYTELEQKLKEEYKQEQEKVNQKPLG
MAFVTFHNESIAALILKDFNACNWQGFTCQGEPRSSSCSDSLNINNWTVSFAPDPQNIYW
ENLSIRGFTWWFRCLIINVVLFLLLFFLTTPAIIITTMDKFNVTKPVEFLNNPIITQFFP
TLLLWCFSALLPTIVYYSTFLESHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLTSLDFF
FRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLLYMIRLCL
AHSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYSITCPIIVPFGLMYMLLKHLVDR
YNLYYAYLPAKLDKKIHAAAVTQVVAAPILCLFWLLFFSILRAGFLAPTSMFTFVVLVIT
IVISLCHLCFGYFKYFSAHNYKIEHTEGGDAADGRGNGARSNVKSAKYIAQVLQDSEEDR
DSGDSGGSRISEAAPPLSLGHDEETLITQEELSDTDFQSYVESLIENEIHP
Download sequence
Identical sequences F7GB17
ENSMODP00000023634 ENSMODP00000023634 13616.ENSMODP00000023634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]