SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023718 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023718
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000271
Family Canonical RBD 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023718   Gene: ENSMODG00000019006   Transcript: ENSMODT00000024141
Sequence length 212
Comment pep:known_by_projection chromosome:BROADO5:5:13925239:14052832:-1 gene:ENSMODG00000019006 transcript:ENSMODT00000024141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSSSSSNSSAKGGGGGSGGGSDKEPSPNDGGLAEEEVRTLFVSGLPLDIKPRELYLLF
RPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTK
MAKNKLVGTPNPSTPLPSTAPQFITREPYELTVPALYPSSPEVWAPYPLYPAELAPALPP
PAFTYPASLHAQMRWLPPSEATSQGWKSRQFC
Download sequence
Identical sequences F7CP63
ENSMODP00000023718 XP_007495649.1.35504 ENSMODP00000023718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]