SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023743 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023743
Domain Number 1 Region: 129-325
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.65e-40
Family DnaQ-like 3'-5' exonuclease 0.00000000724
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023743
Domain Number - Region: 78-115
Classification Level Classification E-value
Superfamily SAP domain 0.000134
Family SAP domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023743   Gene: ENSMODG00000019026   Transcript: ENSMODT00000024166
Sequence length 353
Comment pep:known_by_projection chromosome:BROADO5:5:14971103:14995150:-1 gene:ENSMODG00000019026 transcript:ENSMODT00000024166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEACSARTPAREGQESPLRGGCDGLVPREELKPAGISQSKQHCQLDSQETNGKKPIVSST
SDFSDPVYKEIAVTNGYINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKEKLTQQ
REDGVIADGYYDYICVIDFEATCEEGNPPEFTHEIIEFPIVLLNTHTLEIEDTFQQYVRP
EINTQLSDFCISLTGITQDMVDRAATFPQVLRNVVEWMKLKELGTTYKYSILTDGSWDMS
KFLNIQCQISRLRYPSFAKKWINIRKSYGNFYKVPRNQTKLTIMLEKLGMSYDGRPHSGL
DDSKNIARIAVRMLRDGCELRVNEKMHGGQLTSVSSSSPVEGAPAPQMPHFRN
Download sequence
Identical sequences F7BLL0
ENSMODP00000023743 ENSMODP00000023743 XP_007495662.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]