SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023788 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023788
Domain Number 1 Region: 12-262
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.87e-94
Family CAF1-like ribonuclease 0.000000000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023788   Gene: ENSMODG00000025331   Transcript: ENSMODT00000024212
Sequence length 285
Comment pep:novel chromosome:BROADO5:X:21673456:21674310:-1 gene:ENSMODG00000025331 transcript:ENSMODT00000024212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVAHAEQSPRIREVWACNLDEEMKKMRPVIQQYNYVAMDTEFPGVVARPVGEFRSYADY
QYQLLRCNVDWLKIIQLGLTFMNEQGECPPGTSTWQFNFKFNLKEDMYAQDSIELLTMSG
IQFKKHEEEGIEAQYFAELLMTSGVVLCDGVKWLSFHSGYDFGYFIKILTNSPLPEEAHD
FFEILKLFFPVIYDIKYLMKSCRNLRGGLQEVATQLELERVGAQHQAGSDSLLTGLTFFK
MREMFFEDHIDDAKYSGYLYGLGSGATHAYSNSSRAYHSGYHNNF
Download sequence
Identical sequences F7AXX7
ENSMODP00000023788 13616.ENSMODP00000023788 ENSMODP00000023788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]