SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023789 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023789
Domain Number 1 Region: 12-262
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.96e-98
Family CAF1-like ribonuclease 0.000000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023789   Gene: ENSMODG00000019055   Transcript: ENSMODT00000024213
Sequence length 285
Comment pep:known_by_projection chromosome:BROADO5:5:15910788:15931917:1 gene:ENSMODG00000019055 transcript:ENSMODT00000024213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAATVDHSQRICEVWACNLDDEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADY
QYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSG
IQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELD
FFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFK
MREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEASKQS
Download sequence
Identical sequences F7AXX2 G3WEH6
ENSSHAP00000013831 XP_001364122.1.35504 XP_007495682.1.35504 XP_012407389.1.9362 XP_012407390.1.9362 XP_012407392.1.9362 XP_020832414.1.61212 XP_020832415.1.61212 ENSMODP00000023789 13616.ENSMODP00000023789 ENSSHAP00000013831 ENSMODP00000023789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]