SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023826 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023826
Domain Number 1 Region: 304-388,449-509
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.91e-22
Family Canonical RBD 0.00035
Further Details:      
 
Domain Number 2 Region: 197-286
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.6e-17
Family Canonical RBD 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023826   Gene: ENSMODG00000019088   Transcript: ENSMODT00000024250
Sequence length 531
Comment pep:known_by_projection chromosome:BROADO5:5:18728408:18742463:-1 gene:ENSMODG00000019088 transcript:ENSMODT00000024250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVYARARAPLSCSLQLPPGPAAHVPGAPCPALDSVPSQFPLPPLEPAPAPPPMAGTRWV
LGALLRGCGCNCSSCRRTGAACLPLYTAAGAFPAGVSGRRRLLLLLGAAAAAAAQTRSLQ
AGRLVGPPPSPAAATSGPVAAAAASFQALRGPLLSSAVPVAAPSVGRGYSQDSNTYLEEL
PPLPEYDLTSSKLGEEEEDDVYLIRAQGLPWSCTVEDVLKFFFDCRIRNGENGIHFLLNR
DGKRRGDALVEMESEQDVKKALEKHHLYMGQRYVEVYEINNEDVDALMKSLQAKSNPAVN
DGVVRLRGLPYSCNEKDIVDFFAGLNIIDITFVMDHRGRKKTGEAYVQFEEPEMANQALL
KHKEEIGNRYIEIFPSRRNEVRTHVGSHKGKKVAPSLLKGGPEPGPSLDEHDRSEELRAM
MTFESEKEGELHKEAPEKSAEAADFGTMPSLHFVHMRGLPFQANAQDIVNFFAPLKPVRI
TMEYSSSGKATGEADVHFETHEDAVAAMGKDRSHVQHRYIELFLNSCPKGK
Download sequence
Identical sequences F7FNC0
ENSMODP00000023826 XP_001364439.2.35504 ENSMODP00000023826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]