SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023866 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023866
Domain Number 1 Region: 224-349
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.58e-18
Family Canonical RBD 0.0001
Further Details:      
 
Domain Number 2 Region: 343-384
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000000000746
Family Ran binding protein zinc finger-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023866   Gene: ENSMODG00000019123   Transcript: ENSMODT00000024290
Sequence length 445
Comment pep:known_by_projection chromosome:BROADO5:2:499074347:499101230:-1 gene:ENSMODG00000019123 transcript:ENSMODT00000024290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSGSYGQSGGDQQSYSSYGNQSNQSYGQAPQGYSGYGQTADSSYGQNYGGYSSYGQSQ
SGYSQSYGGYENQKQSSYGQQSYNNQGQQNTDSSGGQGGRAPSYDQSDYGQQDSYDQQSG
YDQHQGSYDEQSNYDQQQDSYNQNQQSYHSQRESYSHHTQDDRRDMSRYGEDNRGYGGSQ
GGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPKTDADSESDNSDNNTIFVQGL
GEGVSTDQVGDFFKQIGIIKVSSLPGKPMINLYTDKDTSPKGEATVSFDDPPSAKAIDWF
DGKEFHGNIIKVSFATRRPEFLRGGGSGGGRRGSRGGYRGRGGFQGRGGDPKSGDWVCPN
PSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGGGYGG
DRGGGYGGKMGGRNDYRNDQRNRPY
Download sequence
Identical sequences F7EV55
ENSMODP00000023866 ENSMODP00000023866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]