SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023873 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023873
Domain Number 1 Region: 303-355
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000221
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023873   Gene: ENSMODG00000019129   Transcript: ENSMODT00000024297
Sequence length 359
Comment pep:known_by_projection chromosome:BROADO5:2:499348003:499352565:1 gene:ENSMODG00000019129 transcript:ENSMODT00000024297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHGAHITAASGADDRPSIFEVVAQDSLMTAVRPALQHVAKVLAESNPAHYGFLWRWFD
EIFTFLDLLLQQHYLSKASASFSENFYGLKRIVTGDPQGVQRLASVGLPKKQLWKSLLFL
VLLPYLKVKLEKLVSSLREEDEYSIHPPSSCWKRFYRAFLAAYPFVTMAWEGWFLIQQLR
YILGKAQHHSPLLSLAGVRLGRLSAEDIRALEKTLAQASGMPQPATSIQEKVQSAVKKAI
GGLALSISTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSSLLPKL
KTVCPLCRKIRVNDTALATSGYVFCYRCVYNYVKSHQTCPITGYATEVQHLVKLYSPEN
Download sequence
Identical sequences F7EUL9
ENSMODP00000023873 XP_001373562.2.35504 ENSMODP00000023873 13616.ENSMODP00000023873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]