SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023881 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023881
Domain Number 1 Region: 1675-1756
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000189
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 619-700
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000205
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 277-351
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000753
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 1144-1224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000954
Family I set domains 0.025
Further Details:      
 
Domain Number 5 Region: 88-170
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000355
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 1848-1928
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000121
Family I set domains 0.022
Further Details:      
 
Domain Number 7 Region: 987-1053
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000252
Family I set domains 0.021
Further Details:      
 
Domain Number 8 Region: 813-885
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000274
Family I set domains 0.02
Further Details:      
 
Domain Number 9 Region: 1339-1405
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000274
Family I set domains 0.019
Further Details:      
 
Domain Number 10 Region: 1521-1588
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000551
Family I set domains 0.021
Further Details:      
 
Domain Number 11 Region: 1242-1330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000202
Family I set domains 0.018
Further Details:      
 
Domain Number 12 Region: 890-978
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000238
Family I set domains 0.017
Further Details:      
 
Domain Number 13 Region: 683-793
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000262
Family I set domains 0.017
Further Details:      
 
Domain Number 14 Region: 1067-1154
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000604
Family I set domains 0.0084
Further Details:      
 
Domain Number 15 Region: 459-525
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000707
Family I set domains 0.029
Further Details:      
 
Domain Number 16 Region: 1770-1858
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000733
Family I set domains 0.015
Further Details:      
 
Domain Number 17 Region: 362-452
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000116
Family I set domains 0.014
Further Details:      
 
Domain Number 18 Region: 1418-1502
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000211
Family I set domains 0.021
Further Details:      
 
Domain Number 19 Region: 187-274
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000285
Family I set domains 0.016
Further Details:      
 
Domain Number 20 Region: 539-626
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000761
Family I set domains 0.018
Further Details:      
 
Domain Number 21 Region: 1597-1682
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000131
Family I set domains 0.024
Further Details:      
 
Domain Number 22 Region: 10-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000287
Family I set domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023881   Gene: ENSMODG00000027945   Transcript: ENSMODT00000024305
Sequence length 1970
Comment pep:novel chromosome:BROADO5:Un:21281350:21694998:1 gene:ENSMODG00000027945 transcript:ENSMODT00000024305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYAPLSKPTILISNNTAVETKDFSMTCNATGQIHAYRWFINGLAAAGSRIQLSPDKSTL
TLPRLTRRDNKGPYVCEIENPLFRNRSDPFPLDVTYGPDIATIVRRPDVYPPGANITLSC
VADSNPPAQFTWLQNGQRIGNSATFSIIASLSVAGTYTCTASNSFTGLTRTATKNIMIYA
PLSKPTIITSNNTAVESKDFSMTCNATGQIHAYRWFINGLAPGGNRIQLSPDKRTLTIRS
LRRTENKGPYVCEIENPLFRKRSNPFTLNVTNGPDNVTIVHSANEYPSGANITLSCVADS
NPAAQFTWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNIIIYAPLSK
PTIVTSNITAVETKDFSLTCQATGQIHAYQWFINRVAPAGSRIQLSPDKRTLTLSRLTRR
DNKGPYECEIRNPFYSNRSDAFTLDVAYGPDIATIDHISDQFATGINVTLSCVADSNPPA
QFTWLQNGQSVSNSASFSIITSLNHIVNYTCIATNSFTGLTRTANKTLMIYAPLSKPTIL
TSNNTAVETKDFSLTCNSTGQIHAYKWFINGVAPAGHRIQLSPDRRTLTLRSLTRSVNKG
PYVCEIENPFYRNRSDPFTLDVAYGPDIATIVHSPDEYPTGANITLSCVADSNPAAQFTW
LHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNIIIYAPLSKPTIVTSNI
TAVETKDFSLTCQATGQIHAYQWFINGVATAGNRIQLSPDKRTLTLSRLTRFDNKGPYEC
EIRNPFYSNSSDAFTLDVAYGPDTATIDRISDQFATGINVTLSCVADSNPPAQFTWLQNG
QSVSNSASFSIITSLNHIGNYTCIATNSFTGLKRTANKTLMIYAPLSKPTIVTSNITAVE
TKDFSLTCQATGQIHAYQWFINGVAPADSRILLSPDKRTLTLSRLTRRDNKGPYECEIRN
PFYSNRSDPFTLDVAYGPDIATIDHISDQFATGINVTLSCVADSNPPAQFTWLQNGQSVS
NSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLSKPTIITSNNTAVETKDF
SMTCNATGQIHAYRWFINGLAPGGNRIQLSQDNRTLTIRSLRRTENKGPYVCEIENPLFR
KRSNPFTLNVTYGPDIATIVHSADEYPTGANITLSCVADSNPAAQFTWLHNGQPVSNSAT
FSVIGSLNHAGTYTCIASNSFTGLMRTATKNIIIYAPLSKPTIVTSNITAVETKDFSLTC
QATGQIHAYQWFINGVAPAGSRIQLSADKRTLTLSRLTRRDNKGPYECEIRNPFSSNRSE
PFTLDVAYGPDIATIDHISDQFATGINVTLSCVADSNPPAQFTWLQNGQSVSNSASFSII
TSLNHIGNYTCIATNSFTGLTRTAKKTLMIYAPLSKPTIVTSNITAVETKDFSLTCQATG
QIHTYQWFINRVAPAGSMIQLSPDKRTLTLSRLTRRDNKGPYECEIQNPFSSNRSEPFTL
DVAYGPDIATIDHIRDQFATGINVTLSCVADSNPPAQFTWLQNGKSVNNSASFSIITSLN
HIGNYTCIATNSFTGLTRTAKKTLMIYAPLSKPTILTSNNTEVETKDFSLTCNATGQIHA
YKWFINGVAPAGRRIQLSPDRRTLTLSSLTRSINKGPYVCEIENPFYRNRSDPFTLDVAY
GPDIATIVHSPDEYPTGANITLSCVADSNPAAQFTWLHNGQPVSNSATFSIIASLSDAGT
YTCTASNSFTGLTRTATKNIIIYGPVSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWF
INRVAPAGSRIQLSPDKRTLTLSRLTRRDNKGPYECEIRNPFYSNRSDPFTLDVAYGPDI
ATIVRSAGVYPTGVNITLSCVADSNPPAQFTWLQNGQSVSNSAIFSVISSLNHAGTYTCI
ASNSFTGMKRTRTKNIYIYGEYLDWATNFVLASLFPWYERNRHKIFCLVP
Download sequence
Identical sequences M9MMI1
ENSMODP00000023881 ENSMODP00000023881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]