SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023979 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023979
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily NTF2-like 1.17e-35
Family NTF2-like 0.0033
Further Details:      
 
Domain Number 2 Region: 336-447
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-19
Family Canonical RBD 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023979   Gene: ENSMODG00000019205   Transcript: ENSMODT00000024403
Sequence length 491
Comment pep:known_by_projection chromosome:BROADO5:5:22778879:22838108:-1 gene:ENSMODG00000019205 transcript:ENSMODT00000024403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLTLRSKEMVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKP
QEAVYGQNDIHHKVLSLKFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPDRKFMQT
FVLAPEGSVPNKFYVHNDMFRYEDEVFCDSEPELDEESEEEVEEEQEERQPSPEPVQESA
NSAYYETHPVTNGIEEPLEESSHDPEPEPESETKTEELKPPVEEKNLEELEEKSASPPPA
EPVSLPQEPPKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRIETKSEAQSQPPRV
REQRPRERPGFPPRGPRPGRGDMEQNESDNRRIIRYPDSHQLFVGNLPHDIDENELKEFF
MSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILVAKPIMFRGEVRLNVEEKKTRA
ARERETRGGGDDRRDLRRNDRGPGGPRGIVGGGMMRDRDGRGPPPRGGMAQKLGSGRGAG
QMEGRFTGQRR
Download sequence
Identical sequences F6ZIS3
ENSMODP00000023979 ENSMODP00000023979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]