SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024075 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024075
Domain Number 1 Region: 135-287
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.32e-23
Family Retroviral integrase, catalytic domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024075   Gene: ENSMODG00000019288   Transcript: ENSMODT00000024502
Sequence length 530
Comment pep:known_by_projection chromosome:BROADO5:3:5052212:5095395:-1 gene:ENSMODG00000019288 transcript:ENSMODT00000024502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRSGKNGGLHLKQIAYYKRTGEYHPTTLPSERSGIRRAAKKFEFKEKKLFYVGKDKKQS
RLVIISEEEKSKVLRECHENNTGTHHGISRTLTLVESGYYWTSVTNDVKHWVYSCQHCQV
AKNSAVLAQRYQPLPVEEPWAAVTADLMGPFPSSSRSHVYAVIVTDAFTKWVVALPLRDV
AASEVSRAIISLFFLYGPPQRVVMDQGDEFINQINGEILGLLGTMANGSRFYPSQPDDAS
ERTANTIKMFLSKYCLDHPNDWDDHLLAISYAFNLTHLEPSKNIPYFQMFNRNPEELRAL
DMFHEGEGDSTCMFAKILRAVKEADKIMLNKTTPTCQMDSHTQDEAQSKSKIILKRRPKQ
LNPFHLKIGHEVLRQRKNWWKDGRFHSEWVGPCVIDYITEKGCAVLRDKTGARLKRPIKM
SHLKPYIRDSGEQDSHYHLHDPVVTDHDYVGLAEIPIGSYQPEILVEDAPLCAADENLPA
PNTGQELSESNSSKVSRLLEDGAVQPVHLDLGKPAFSLLDASSHGLEYLS
Download sequence
Identical sequences F6RZV1
XP_007486305.1.35504 XP_007486306.1.35504 XP_007486307.1.35504 XP_007486308.1.35504 XP_016286772.1.35504 XP_016286773.1.35504 ENSMODP00000024075 13616.ENSMODP00000024075 ENSMODP00000024075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]