SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024080 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024080
Domain Number 1 Region: 345-466,516-754
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 5.49e-59
Family Tex N-terminal region-like 0.01
Further Details:      
 
Domain Number 2 Region: 776-930
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.64e-24
Family Tex RuvX-like domain-like 0.0079
Further Details:      
 
Domain Number 3 Region: 945-1037
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000289
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 
Domain Number 4 Region: 1325-1416
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000249
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 5 Region: 1226-1283
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000936
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Domain Number 6 Region: 1050-1138
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000667
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024080   Gene: ENSMODG00000019291   Transcript: ENSMODT00000024507
Sequence length 1726
Comment pep:known_by_projection chromosome:BROADO5:2:506593938:506633034:1 gene:ENSMODG00000019291 transcript:ENSMODT00000024507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFVESEAEESEEEYNDEGEVVPRVNKKFVEEEEDDEEEEEENLDDQDEQGNLKGFIND
DDDEEEEEEDEASDSGDSEDDVGHKKRKRTAFDDRLEDDDFDLIEENLGVKVKRQKFRRV
RKMSDDEDDDEEEYGKEEHEKEAIAEEIFQDGEGEEGQEAVEAPMTAPEEEEEEDEESDI
DDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEEYE
YEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQLR
SIPVKAAEDDELEEEADWIYRNAFATPTISLQESSDYLDRGQPVNNFSRKGPSTVQKIKE
ALGFIRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLKIRKENLTRLFEKMQ
AYQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYNHFLLYYGRDIPKMQNA
AKASRKKLKRIREDGDEEEGEGEEVEDEQKGPELKQASRRDMYTICQSAGLDGLAKKFGL
TPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPL
VRQVLRQTFQERAKVNITPTKKGKKDVDEAHYAYSFKYLKNKPVKELRDDQFLKTCLAEE
EGLLTIDISIDMKGVEGYGSDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQFL
YVQMAKELKNKLLAEAKEFVIKACSRKLYNWLKVAPYRPDQQVEEDDDFMDENQGKGIRV
LGIAFSSARDHPVFCALVNGDGEVTDFLRLPHFTKRRTAWREEEREKKAQDIETLKKFLL
NKKPHVVTIAGENRDAQMMIEDVKRIVHELDQGQQLSSIGVEMVDNELAVLYMNSKKSEA
EFRDYPPVLRQAVSLARRIQDPLIEFAQVCSTDEDILCLKFHPLQEHVVKEELLNALYCE
FINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTMC
HMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAE
DANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTAY
RSPNTEEVFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAIRNDETGLWQCPFC
QQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGM
TVHCRIMKIDIEKFSADLTCRTSDLMDKNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQ
RTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHV
DVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQECGGGDRK
KLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVSVTPEGFRYRGQVF
PTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADLTRAVNALPQNMTS
QMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPSY
SYTTPSQPITTPQYHQLQTNTTPQSTQAQPQPQPSSSSRHRQQPKSNSHAAIDWGKMAEQ
WLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR
Download sequence
Identical sequences F6RZE3
ENSMODP00000024080 ENSMODP00000024080 13616.ENSMODP00000024080 XP_001368732.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]