SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024214 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024214
Domain Number 1 Region: 800-1099
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.35e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00001
Further Details:      
 
Domain Number 2 Region: 158-302
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-35
Family Third domain of FERM 0.0014
Further Details:      
 
Domain Number 3 Region: 50-156
Classification Level Classification E-value
Superfamily Second domain of FERM 1.2e-29
Family Second domain of FERM 0.00033
Further Details:      
 
Domain Number 4 Region: 1-49
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000163
Family First domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024214   Gene: ENSMODG00000019412   Transcript: ENSMODT00000024643
Sequence length 1104
Comment pep:novel chromosome:BROADO5:Un:45720816:45724199:-1 gene:ENSMODG00000019412 transcript:ENSMODT00000024643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQQITYFSLWYYNKQNQSRWVDLDKPLKKQLDKYALEPTVYFGVVYYVPTVSQLQQEITR
YQYYLQLKKDILEGNIPCTLEQAIHLAGLAVQADFGDFDQYESQDFLQRFALFPVGWLQD
EKVLEEATQKVALLHQKYRGLTPPDAEMLYMQEVERMDGYGEESYPAKDSQGSDICIGAC
LDGIFVKHKNGRPPVIFRWHDIANISHNKSFFALELTNKEETIQFQTEDMETAKYVWRLC
VARHKFYRLNKCNLQTQTLAVNPVRRRSSSRMSLPKPQPYVMPPPPQLHYNGHYTEPYSS
SQDNLFGNNQNGYYCHSQTSLDRALDYNGRIRNGSVYSAHSTNSLNNPQPFLQPSPMSSN
PSITGSDVMRPDYVPTHRHSALIPPSYCPTPDYETVMRQLNRGVSHAERQSHSLRNLNIG
NSYAYSRPDALVYSQPEIRDRAQFTSPYFHSQSPYPYPTERRPVVGAVSVPELTNVQLQA
QDYPAPNIMKTQVYRPPPPYPYPRPANSTPDLSRHLYISSSNPDLITRRVHHSVQTFQED
SLPVAHSLQEVSEPLTSVRHAQLKKRNSIEIAGLTHSFEGIRLKERTMSASAADPNVFIE
RTKQEENEEQENVRYGHKKSLSDATMLIHSSEEEEEDFEEESKARTVLSPHPDETTQLSS
GIGGFSKEPLLGYPYGSLTPGPNPLHILEPKSHMLETEKSVRAISPVHLIVEAQVPRREG
LLTPSMSESDLTTSGRYRGKRDSLKKRPVLDILSGKKNVVEGLPPLGGMKKNRADAKKCG
PLKLAALNGLSLSRMPLPDEGKEVPTRATNDERCKILEQRLEQGMVFTEYERILKKRRID
GECAIARLPDNAERNRFQDVLPYDDTRVELVPTKENNTGYINASHIKVSVGGIEWDYIAT
QGPLQNTCQDFWLMVWEQGIAIIAMATAEEEGGREKSFRYWPRLGSRHNTVTYGRFKITT
RFRTDSGCYATTGLKIKHLLTGQERTIWHLQYTDWPEHGCPEDLKGFLSYLEEIQSVRSH
TNSTTEPKSPNPPLLVHCSAGVGRSGVVILSEIMIACLEHNDMLDIPRVLEMLRHQRMMM
VQTLCQYTFVYRVLIQFLRNSRLI
Download sequence
Identical sequences H9H7D0
ENSMODP00000024214 13616.ENSMODP00000024214 ENSMODP00000024214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]