SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024272 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024272
Domain Number 1 Region: 550-817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-81
Family Protein kinases, catalytic subunit 0.000000873
Further Details:      
 
Domain Number 2 Region: 12-283
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-53
Family FCH domain 0.004
Further Details:      
 
Domain Number 3 Region: 441-578
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-28
Family SH2 domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024272   Gene: ENSMODG00000019456   Transcript: ENSMODT00000024702
Sequence length 822
Comment pep:known_by_projection chromosome:BROADO5:1:121476502:121661100:1 gene:ENSMODG00000019456 transcript:ENSMODT00000024702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSELCSPQGHGALQRLQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMALQEGGSQV
RNLDHVSQISQSWAEITRQTESLSRLLRQHAEDLNSGPLSKLSILIRERQQLRKSYSEQW
QQLQQDLTKIHNLDIEKLKSQYRVLARDSAQAKRKYQEASKDKDRDKAKDKYVRTLWKLY
AHHNRYVLGIRAAQLHHQHHHQLLLPGLLQSLQDLHQEMALILKEILQEYIEISSLVQDE
VVSIHREIAAAAACINPHTEYEGFLQQYGSPPSAPPCVAFDDSLLEEGEQLEPGELQLNE
LTIESVQHSLTSVNEELTTAREMVISRQQVVTQLQREIQREEESIHPRERVQLLGKRQVL
QEALQDFQMALCSQAKLQAQQDLLQNKLDQLGPGEPPPVLVLQDDQHSTSSTEQDRDGGR
TPTLEILKNHISGIFRPRFSLPPPLQLIPDIQKPLQDQVWYHGAIPRTEVQELLVNSGDF
LVRESQGKQEYVLSVLWDGQPRHFIIQSSDNLYRLEGDGFPSIPLLIDHLLRSQQPLTKK
SGISLNKAVPKDKWALNHEDLVLGERIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKLL
LQMVGDAAAGMEYLESKHCIHRDLAARNCLVTEKNILKISDFGMSREGADGIYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYSNLSNQQTRELIEKGGRLP
CPDLCPDAVFRLMEQCWAYDPSQRPNFSAIHQELQGIRKRHR
Download sequence
Identical sequences F6RWR2
ENSMODP00000024272 XP_003340018.1.35504 XP_007479358.1.35504 13616.ENSMODP00000024272 ENSMODP00000024272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]