SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024291 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024291
Domain Number 1 Region: 260-532
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.42e-78
Family Protein kinases, catalytic subunit 0.000000000371
Further Details:      
 
Domain Number 2 Region: 120-292
Classification Level Classification E-value
Superfamily SH2 domain 1.99e-37
Family SH2 domain 0.0000159
Further Details:      
 
Domain Number 3 Region: 89-129
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000455
Family SH3-domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024291   Gene: ENSMODG00000019471   Transcript: ENSMODT00000024721
Sequence length 538
Comment pep:known_by_projection chromosome:BROADO5:1:401380029:401423855:-1 gene:ENSMODG00000019471 transcript:ENSMODT00000024721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQKRRGPQKTEVGAPGAGLKPQKLGHFGRLKARMGCVKSRFNQDGRKIFKKDSPTNNQG
PVYVPDPTSPGKRVVNGANQSISSDASENVDITVVALYDYEAIHNEDLSFRKGDQMAILE
KSGEWWRARSLATRKEGYIPSNYVAQVNSLETEEWFFKDISRKDAERHLLAPGNVLGSFM
IRDSETTKGSYSLSIRDYDPQHQDAVKHYKIRTLDNGGFYISPRSTFSTLQDLVAHYKKG
SDGLCQKLTVACVVPKPQKPWEKDAWEIPRESLKFEKKLGAGQFGEVWMATYNKHTKVAV
KTMKPGSMSVEAFLAEANLMKTLQHDKLVKLHAVVTKEEPIYIITEFMAKGSLLDFLKTD
EGRRQPLPKLIDFSAQIAEGMAFIELRNYIHRDLRAANILVSSALVCKIADFGLARLIED
NLYNAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIR
SLDHGYRMPRTENCPEELYSIMTRCWMNKPEDRPTFEYLQSVLEDFYTATESQYQKQP
Download sequence
Identical sequences F6RBD8
XP_016283998.1.35504 ENSMODP00000024291 ENSMODP00000024291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]