SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024370 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024370
Domain Number 1 Region: 37-158
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-16
Family Growth factor receptor domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024370
Domain Number - Region: 138-191
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000222
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024370   Gene: ENSMODG00000019537   Transcript: ENSMODT00000024802
Sequence length 223
Comment pep:known_by_projection chromosome:BROADO5:1:403597088:403648944:-1 gene:ENSMODG00000019537 transcript:ENSMODT00000024802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWILLILLLFGNAVEMFALNHSKKQVGVGLKDNCTGCLICSEENGCSTCQPRLFLHIRR
DGIRQYGKCVHDCPHGYFGVRGHEVNRCKKCGSTCESCFSQDFCIRCKKRFFLHKGKCAP
TCPPGTIAQQSTWECQEECEFGPWSLWSPCLQDGKTCGSAWGLETRVREVSRGSREEGTA
ACQALSESRNCAIRRHCPGEKNLTRRRGRKERRHRKERKMEHS
Download sequence
Identical sequences F6UUJ8
13616.ENSMODP00000024370 ENSMODP00000024370 ENSMODP00000024370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]