SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024410 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024410
Domain Number 1 Region: 681-958,999-1154
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-74
Family DNA polymerase I 0.0031
Further Details:      
 
Domain Number 2 Region: 110-130,167-288,322-397
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000105
Family DnaQ-like 3'-5' exonuclease 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024410   Gene: ENSMODG00000019564   Transcript: ENSMODT00000024843
Sequence length 1197
Comment pep:known_by_projection chromosome:BROADO5:1:122789192:122824765:1 gene:ENSMODG00000019564 transcript:ENSMODT00000024843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLVWRVIAARGVLPWCFQRWASGSSVSQQFCEAEASSVGLRDECQKRENALHIQMLSR
GLHEQIFGQPEMQPSEEAIQQSVEHLQKHGLWGQETSALPDVELQLPRLYGEDLDEHFRI
LAQKQSLPYLEAAHELLQAELPPLPNKWAWKEGWTRYEPDGKGQQVEFPEERALVFDVEV
CIAEGSCPTLAVAVSPNSWYSWCSRRLLEERYSWARSLYLSDLIPLETPAGISGPAKQDW
SERLIVGHNVCFDRAFIKEQYLIQGSRMRFLDTLSMHMAISGLSSFQRSLWIAAKQGKQK
GSQMVQKHIKKTQSKAKGPLIYAWDWLDISSINNLADVHSLYVGGPPLEKEARELFVKGT
MKDIRENFQDLMQYCALDVQATYEVFQEQLPLFMERCPHPVTLAGMLEMGVSYLPVNQNW
ERYLVEAQSTYEELQREMKKSLMDLANDACHLVSGDRYKDNPWLWDLEWDLQEFKLKKKK
IRKNDQNISCRSPAKAKNSSEMEWQEDPGPPIEEEELQSDSAIRTRMEELKETAILLPKR
CQHLPGHPGWYRKLCPRLNDPDWIPGPSLISLQMRVTPKLMMLTWDGFPVHYSEKHGWGY
LVPGRQDNLLVDSSETDVAACPYRAIEALYQKYCQETGKEQLVFQPLPEEFMLTDSTVWQ
TVEELSRLEPDADFETDRATQEETNSLQLSQPAYHHGNGPYNDVNIPGCWFFKLPHKDGN
NYNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMVSFWRNAHKRISSQMVVWLQK
GELPRTVIRHKDYDEECYYGAILPQVVTAGTITRRAVEPTWLTASNARVDRVGSELKAMV
QAPPGYVLVGADVDSQELWIAAVLGDAHFARIHGSTAFGWMTLQGKKSSGTDLHSKTAST
VGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTPQQAKEKAQQMYAVTKGLRRYQLS
KDGEWLVKELGIQVDRKEDGWVSLQDLRKIQKAASRMSYRKKWNLVADRAWAGGTESEMF
NKLESIAMSDAPRTPVLGCQISRALEPAVVQGEFVTSRVNWVVQSSAVDYLHLMLVAMKW
LFEEFDISGRFCISIHDEVRYLVTEKDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVA
FFSAVDIDRCLRKEVTMDCKTPSNPTGLERRYGIPQGEALDIYQIIKLTKGSLEKRS
Download sequence
Identical sequences F6R8C1
ENSMODP00000024410 XP_007479414.1.35504 ENSMODP00000024410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]