SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024435 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024435
Domain Number 1 Region: 129-292
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.2e-34
Family DnaQ-like 3'-5' exonuclease 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024435   Gene: ENSMODG00000019584   Transcript: ENSMODT00000024868
Sequence length 334
Comment pep:known_by_projection chromosome:BROADO5:1:123516527:123524259:-1 gene:ENSMODG00000019584 transcript:ENSMODT00000024868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATHGPLAELAGMTSKESSKSFQGSSAPLTNSTGKDTPRWWYKRRSRRHQRFMVHKALLE
KRGVLSVPPESENPLQVTRPEGLEDTEASKYGVQQDALGSPGPQPRRKQLQKMEPNKGTA
SGHAMPNKCVAIDCEMVGTGPGGRVSELARCSVVSYHGDVLYDKYIRPETPIVDYRTRWS
GITRQHMQNAIPFRVAQKEILKLLKGKLVVGHALHNDFRALKYFHPRRQTRDTLSVPSLI
NQTGFPVRAQSSSLKNLALQLLNKRIQVGQHGHSSVEDATTAMELYRLVEAQWEQKEASS
HPSSLEDNLQDSGTDTEHYMEDQYWLEDQTEGCK
Download sequence
Identical sequences F6QM71
ENSMODP00000024435 XP_007479436.1.35504 XP_007479437.1.35504 XP_007479438.1.35504 XP_016283876.1.35504 ENSMODP00000024435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]