SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024566 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024566
Domain Number 1 Region: 123-301
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.000000417
Further Details:      
 
Domain Number 2 Region: 622-728
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-30
Family SH2 domain 0.000000963
Further Details:      
 
Domain Number 3 Region: 330-437
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-30
Family SH2 domain 0.000000627
Further Details:      
 
Domain Number 4 Region: 10-89
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-16
Family SH3-domain 0.00000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024566   Gene: ENSMODG00000019685   Transcript: ENSMODT00000025002
Sequence length 731
Comment pep:known_by_projection chromosome:BROADO5:3:34148849:34232240:1 gene:ENSMODG00000019685 transcript:ENSMODT00000025002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLAKMSAEGYQYRALYEYKKEREEDIDLHVGDVLTVNKGSLVALGFSEGEEAKPDEIG
WLNGYNETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKLETDNEQQGFT
LLDLTEQFSSPAVAPPILIKLVEAIEKKGLECPTLYRTQSSSSLAELRQLLDCDASSVDL
DVIDVQVLSDAFKRYLLDLPNPVIPGTIYSEMISVAQELQNSEENVQMLKKLMRTPHIPH
QHGLTLQYLLKHFFKLCQASSKNLLNARSLSEIFSPVLFRFPNTGSDNAEHLIKTIELLI
SSEWNERQPAPALPPKPPKPTTVTANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADG
TFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESL
AQYNPKLDVKLLYPVSKYQQDQVVKEDSIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRT
SQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKS
RISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKK
LNEWLGNENTEDQYSMVEDDEDLPHHDERTWNVGSSNRSKAENLLRGKRDGTFLVRESSK
QGCFACSVVVDGEVKHCVINKTPTGYGFAEPYNLYNSLKELVLHYQHTSLVQHNDSLNVT
LAYPVNAQQRR
Download sequence
Identical sequences F6TD14
ENSMODP00000024566 XP_001367149.2.35504 ENSMODP00000024566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]