SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024621 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024621
Domain Number 1 Region: 1178-1399
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.16e-49
Family Phosducin 0.00000287
Further Details:      
 
Domain Number 2 Region: 8-58
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000495
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 409-441
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000122
Family CCCH zinc finger 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024621   Gene: ENSMODG00000019725   Transcript: ENSMODT00000025057
Sequence length 1424
Comment pep:known_by_projection chromosome:BROADO5:1:416716052:416792026:-1 gene:ENSMODG00000019725 transcript:ENSMODT00000025057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAINTD
IDVLPVNFALLQLVGAQVPDHQTVKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVAS
LNQSALSRPMQRKLVTLVNCQLVEEEGRVRAMRAARSLGERTVTELILQHQNPQQLSANL
WAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIG
HVVQLLYRASCFKVTKRDEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLRISPEQW
SSLLYGDLAHKSHMQSIIDKLQSPESFAKSVQELTIVLQRTGDPANLNRLRPHLELLANI
DPNPDAVSPTWEQLENAMVAVKTVVHGLVDFIQNYSRKGHDTPQPQPNSKYKTSMCRDLR
QQGGCPRGTNCTFAHSQEELEKYRLRNKKITATVRTFPLLNKVGVNNTVTTTAGNVISVI
GSTETTGKLVPSTNGISNAENSVSQLIPRGADTTLRALENVKKVGKVGSSGQNISGASAE
SVTENKIGSPPKTPVSNVAATSAGPPTVGTELNSVPPKSSSFVTRVPVYPQPSESIQYFP
DPRTQISFEVPQYPQTGYYPPPPTVPAGVAPCVPRFVRSNNVPESSLPPASVPYADHYST
FPPRDRVNSSPYQPPPPQPYGPVPPVPSGMYAPVYDSRRIWRPPMYQRDDIIRSNSLPPM
DVMHSSVYQTSLRERYSSSLDGYYPMACQPPSEPRTTVPLPREPCGHLKTSYEDQLRRKP
EQWAQYHTQKAPLVSSTLPVATQSPTPPSPLFSVDFRTEFSENVNDVRGTKFEEDHLSHY
SPWSCGTIGSCINAIDSEPKDVIANSNAVLMDLDSGDVKRRVHLFETQRRAKEEDPIIPF
SDGPIISKWGAISRSSRTGYHTTDPIQATASQGSATKPISVSDYVPYVNAVDSRWSSYGS
DSTSSAHYIERDRFIVTDLSSHRKHSSTGDLLSIELQQAKSNSLLLQREANALAMQQKWN
SLDEASHLTLNLLSKEMELRNGESDYTEDTTDTKPDRDIELELSALDTDEPDGQGEHIEE
ILDIQLAITSQNDQLLNGTTMENGHPLKQHPKEPVEPKRQSLDTMTTMDDKLLGEKLQYY
YSSSEDEDSEREDKNKGTGLGDSVPGEMELAKDGITVNTGPKGVINDWRRFKQLETEQRE
EQCREMERLIKKLSVTCRSHLDEEDDKQKQKELQDKINGKMTLKEYGVVNDKQDDEEFLQ
QYRKQRMDEMRQQLHSGHHQFSQVFEITSGEAFLDTVDKEQKNTLIVIHIYEDDIPGAEA
MNGCMICLAAEYSSVKFCRVKSSLIGASSRFTNNALPALLIYKGGELIGNFVRVTDQLGE
DFFAVDLEAFLQECGLLPEKEMVLLTSIHNPTACFSEDSDLEID
Download sequence
Identical sequences F6X4V6
ENSMODP00000024621 ENSMODP00000024621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]