SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024686 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024686
Domain Number 1 Region: 269-436
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-45
Family SPRY domain 0.0000835
Further Details:      
 
Domain Number 2 Region: 9-75
Classification Level Classification E-value
Superfamily RING/U-box 1.59e-17
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 93-116
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000198
Family B-box zinc-binding domain 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024686
Domain Number - Region: 218-264
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0194
Family SNARE fusion complex 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024686   Gene: ENSMODG00000019776   Transcript: ENSMODT00000025122
Sequence length 444
Comment pep:novel chromosome:BROADO5:5:101316902:101322689:1 gene:ENSMODG00000019776 transcript:ENSMODT00000025122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAKDLIKSLKAELTCSICLGYFTDPVTAFKCGHTFCKDCLFQCDEQADATLTCPECRAV
IRYSDIVLNENLQNLSITGKTLRQHLLLSPALLTTCDQHGEKEKLFCEQDQKLICDSYLT
KPFFLLQKNLQETLNVLQQKEEELKAEINDMVKEEEYFKKDSDYYKELIKCEYRKMHEIL
YNEENRHLQKLDQEREDKLAKVEANKAKLSQQIQHVQRKILEIEESLDEAPLEMLQDMKG
ILERNEELQLQDPETVNLTYTTYQMTGLIEILRSYQMGITVDPETERLHLIVPEHFKSLK
YNFDPRNHPDNEERHDYFVTVLGTETFTSGKHYWEVDVEGQTEWVLGICEDSVSKNENLS
MSSEDVKAIIGSKVKNQTLFWSSEGCFYWIAANKLGIFLDYDEGNITFYDVNEKTVLISF
RNSPFQGPVRPFFSTSLVNKGSSS
Download sequence
Identical sequences F6W7L0
ENSMODP00000024686 ENSMODP00000024686 13616.ENSMODP00000024686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]