SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024712 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024712
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.25e-26
Family Canonical RBD 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024712   Gene: ENSMODG00000019800   Transcript: ENSMODT00000025149
Sequence length 284
Comment pep:novel chromosome:BROADO5:Un:35432305:35458899:-1 gene:ENSMODG00000019800 transcript:ENSMODT00000025149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFN
GIKIRGRTIRVDHVANYRPPKDSTNLDDITRTIREKGCGVKTPPPSSSDSSEDEMSMKKY
KKDKKEKKMKKKGRDARMTMDDKQEMSTSSSLVSQHKTGKEKEGGGFGKPTIVGLERGTS
PERREGRCDRREGCDGLEGQETSRKEKSWHKKSSGSSSRKEKRKKEKRRHRDRSRSSEKH
SHRHGDHSERGAKKRKHKHKSRSSTKDSHSRDRDPTYSSHHKSS
Download sequence
Identical sequences H9H7G6
ENSMODP00000024712 ENSMODP00000024712 13616.ENSMODP00000024712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]