SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024718 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024718
Domain Number 1 Region: 56-169
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.04e-28
Family Canonical RBD 0.0000175
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000923
Family Canonical RBD 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024718   Gene: ENSMODG00000019803   Transcript: ENSMODT00000025155
Sequence length 254
Comment pep:novel chromosome:BROADO5:Un:83766372:83770704:1 gene:ENSMODG00000019803 transcript:ENSMODT00000025155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVK
KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQ
KYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGR
DGGYNGFGGDGKTFSCCNYGGSGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYGGGY
GSGGGSGGYGSRRF
Download sequence
Identical sequences H9H7H1
ENSMODP00000024718 ENSMODP00000024718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]