SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024842 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024842
Domain Number 1 Region: 107-198,398-482
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.96e-45
Family Canonical RBD 0.00000727
Further Details:      
 
Domain Number 2 Region: 6-102
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.25e-21
Family Canonical RBD 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024842   Gene: ENSMODG00000019913   Transcript: ENSMODT00000025283
Sequence length 486
Comment pep:known_by_projection chromosome:BROADO5:5:284374821:284419426:-1 gene:ENSMODG00000019913 transcript:ENSMODT00000025283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGTLDHPDQPDLDSIKMFVGQVPRSWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKG
CCFVTFYTRKAALEAQNALHNMKILPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCN
ENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSP
IVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTAS
SGNLNTLGSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSGSS
PSSSSSNSVNPMASLGALQTLAGATAGLNVGSLAGMAALNGGLGSGGLSNGTGSTMEALT
QAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQM
FMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSK
NDSKPY
Download sequence
Identical sequences F6VPK7
ENSMODP00000024842 XP_016279005.1.35504 ENSMODP00000024842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]