SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025153 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025153
Domain Number 1 Region: 660-779
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-26
Family Ankyrin repeat 0.00043
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily BRCT domain 1.26e-19
Family BRCT domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025153   Gene: ENSMODG00000020124   Transcript: ENSMODT00000025599
Sequence length 922
Comment pep:known_by_projection chromosome:BROADO5:3:207392495:207508932:-1 gene:ENSMODG00000020124 transcript:ENSMODT00000025599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESAQKHIIQITGFRGKEKEDVTKLLLKLDCTFIKNKQYRNCTHLIAKHACKSEKYLAA
CAAGKWVLTKDYIINSAESGRWLDETTYEWGYKIEKDSHYSPQMQSAPKRWRKELTNTGA
PGAFHRWKVVLLVKEGSKGRDSLTRVLGAGKAQVFLPNNTPKGITHVITMNTNSSAEKAK
YTFEAPYYPVQHLVDFLFLERQFQNDDGAVQRTSLFTEHVQQERKATDSKTDREIADLKK
ALRKHICRVEAMKYSCIELTKIAGCSIEVKNTELPRSIFNTIEILIEGQFFTEALEELVL
LQPHYIPPVCLLHVFLRSMLQGNTMALIDRYFRVLSVLLHLHPPWKSPTMLSYYLEFFQC
PNCMKGIWSFVEVLIRSCLFSESFCHPIPEGIVETKMLSVALLTFFLKLVKREVQHLNHR
LYEGADSQSLKVKEQTFLLKTFWSGNETSVFFTKPINMLLDWTIYSHKEKFKSNDTFKNE
MACLLTGILGAVVEYWIFLGLMKDRNVMQHMSDHLGNYVAVSCDDFSSQELESFINSFSS
SWLQMFIAESVFKKSCLQSCISISPEPLSLQKMVCAYLPALGKINLLELRKGQKRKKMGH
WDGPSSQRALKMLSDGDQNQTNVLPDAPELKHPLSLKRSQKKSEGELSRSKENFLLPKMN
FHKTNLKGETALHRACINNQVEKLILLLSLPGTDINVKDYAGWTPLHEACNHGNTVCVQE
ILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGSVLLQQRTSKGKLPLDYVLA
PQVKEDLLTVLQIKSSTEDLHAQAEEHFYHQQIEFGSFLLSRMLLNFCSIFDLFSNFSVF
KELAHLDGRLFTSPRTRKDATRLHNDWIVDLYSQNLMTLEKLPSLLKEIPKNLEVFPGVQ
TQALLMTLKTMIDQAQSFHGTS
Download sequence
Identical sequences F7DQV8
ENSMODP00000025153 ENSMODP00000025153 XP_001365371.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]