SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025652 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025652
Domain Number 1 Region: 51-174
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-21
Family Synaptotagmin-like (S variant) 0.035
Further Details:      
 
Domain Number 2 Region: 222-271
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000957
Family CUE domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025652   Gene: ENSMODG00000020504   Transcript: ENSMODT00000026109
Sequence length 274
Comment pep:known_by_projection chromosome:BROADO5:Un:26389404:26408600:-1 gene:ENSMODG00000020504 transcript:ENSMODT00000026109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVSTQRGPVYIGELPQDFLRITPTQQQQQIQLDAQAAQQLQYGGALNTVGRLNITVV
QAKLAKNYGVTRMDPYCRIRLGYAVYETATAHNGAKNPRWNKVIQCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLKQGKVEDEWYSLSGRQGDDKEGMINLVMSYSSLPTAMM
TQPQPVVLMPTVYQQGVGYVPITGVPAVCGPGVMPLAVAPPVVSPPAPCSEDDLKAIQDM
FPNMDREVIRSVLEAQRGNREAAINSLLQIGEES
Download sequence
Identical sequences H9H7K3
ENSMODP00000025652 ENSMODP00000025652 XP_001362652.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]