SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025716 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025716
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily UBC-like 1.03e-48
Family UBC-related 0.000000147
Further Details:      
 
Domain Number 2 Region: 156-197
Classification Level Classification E-value
Superfamily UBA-like 1.34e-22
Family UBA domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025716   Gene: ENSMODG00000020556   Transcript: ENSMODT00000026174
Sequence length 199
Comment pep:known_by_projection chromosome:BROADO5:5:184679130:184761771:-1 gene:ENSMODG00000020556 transcript:ENSMODT00000026174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGKYQLEIK
IPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAE
PDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIV
ALSSKSWDVETATELLLSN
Download sequence
Identical sequences F7AQ16 L8I9J4
13616.ENSMODP00000025716 28377.ENSACAP00000011102 ENSMODP00000025716 ENSMODP00000025716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]